SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000016124 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000016124
Domain Number 1 Region: 388-617
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 8.51e-33
Family Calponin-homology domain, CH-domain 0.00015
Further Details:      
 
Domain Number 2 Region: 86-241,385-469
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.73e-24
Family FAD/NAD-linked reductases, N-terminal and central domains 0.073
Further Details:      
 
Domain Number 3 Region: 707-738
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000793
Family LIM domain 0.011
Further Details:      
 
Domain Number 4 Region: 739-770
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000108
Family LIM domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000016124   Gene: ENSTRUG00000006568   Transcript: ENSTRUT00000016196
Sequence length 1160
Comment pep:novel scaffold:FUGU4:scaffold_30:186543:208524:-1 gene:ENSTRUG00000006568 transcript:ENSTRUT00000016196 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGETEDEHLGQASVLFENFVQAHCKGTLQAFSILCRQLQLDPLDYSNFYSSLKAAVSTWK
VKTLWTKLDKKAQQKVYGQNKACQGTRCLIIGGGPCGLRTAIELALLGCKVVLIEKRDTF
SRNNVLHLWPFTIHDLRGLGAKKFYGKFCAGSIDHISIRQLQLMLLKVCLILGVEIHVNV
EFTGLLEPQKEQPDEESGWRAEFQPSGHPLADFHFDVVIGADGRKSTLDGFARKEFRGKL
AIAITANFVNRNTTAEAKVEEISGVAFIFNQKFFLELKEETGIDLENIVYYRDNTHYFVM
TAKKQSLLDKGVIISDHIETERLLSADNVNQEALLSYAREAADFGTNYQLPSLDYAINHY
GQPDVAMFDFTCMYASENATLIREKRGHQLVVALVGDSLLEPFWPMGTGCARGFLAAFDT
AWMVRGWAQGRKPLEILAERESIYRLLPQTTPENISKHFEQYSIDPVTRYPNLNVNYIRP
HQVRHLFINGHLASCHLERKFSNRLRFIQSDVHPGRLLSWCQKQTRGYRGVVITDLTSSW
RNGLALCALIHHQRPELIDFDSLEEEDVAENNQLAFDIAEREFGIQPVIRGEEMAAAAEP
DQLLMVLYLSKFQEAFRSSPANGRAFSSVSLSSAGLKDLIQIESTLSSDSGQTHQTATLP
VDSSPNDNKSPPARSSPSPLGDSDAHETDHRPNAAPCVARKDGAAGLGGSDICHFCSKRV
YVMERLSAEGFFFHRECFRCDVCSCTLRLGGHAFDSREAKFYCKIHYAQRQTSSHMPSYL
PTYLINYLPILLTTCITYSLLLDSGSCSTVDSIQTGPPDTQGEPLRARHCGRGCANPSCD
DLCFNQAASCDWPIPSRGFEDIIAAEETTFADNLKSADGPSKRSLGCSVSAPRKRLMLSV
SEKGKLLNWDAVVTTEESTNSPSNSEEQVDVIKTALSAILAECAWILQEMQKESGMLLTN
IRNDASSGEKEEEAGEDGGPAGEKRTAEEASQSSDPVWVHASLLNIEPKIMLIICEFSTA
QAIQRQLEEVTEKQRSLEERGVAIEKTIRREAGAESLESGDVVEDQLYRTWFKLVLEKNR
LARYESELMIFAQELELEDTQSRLQQDLRQRMAIDATDTKKSASELQEEQEILSEIMRTV
EKRDTLVSLLEEQRLKERAE
Download sequence
Identical sequences H2SUN7
ENSTRUP00000016124 ENSTRUP00000016124 31033.ENSTRUP00000016124

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]