SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000016222 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000016222
Domain Number 1 Region: 28-147
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.06e-32
Family Tandem AAA-ATPase domain 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000016222   Gene: ENSTRUG00000006601   Transcript: ENSTRUT00000016294
Sequence length 150
Comment pep:novel scaffold:FUGU4:scaffold_284:336699:338617:1 gene:ENSTRUG00000006601 transcript:ENSTRUT00000016294 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PKVTYIPPTLPEDEESIFAHYETGINFDKYDDIMVEVSGVTPPQAISTFDDAELCESLRK
SISKSGYIKPTPVQKHGIPIICAGRDLMACAQTGSGKTAAFLLPILQKLMADGVAASSFS
EIQEPEAVIVAPTRELIGQIFLEARKFSFG
Download sequence
Identical sequences H2SUY4
31033.ENSTRUP00000016222 ENSTRUP00000016222 ENSTRUP00000016222

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]