SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000016363 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000016363
Domain Number 1 Region: 12-117
Classification Level Classification E-value
Superfamily PH domain-like 8.92e-28
Family Pleckstrin-homology domain (PH domain) 0.0033
Further Details:      
 
Domain Number 2 Region: 126-239
Classification Level Classification E-value
Superfamily PH domain-like 1.08e-22
Family Pleckstrin-homology domain (PH domain) 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000016363   Gene: ENSTRUG00000006656   Transcript: ENSTRUT00000016435
Sequence length 261
Comment pep:novel scaffold:FUGU4:scaffold_106:546412:547793:1 gene:ENSTRUG00000006656 transcript:ENSTRUT00000016435 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTIGSDIARYPSSPRPACRGYLYKRTQSGLIKGWRKRWFVLTHECCLCYYRHRRDEGRQR
PLHAVRLEGAEVRPHTSLGRPFVFKCCPQAGSRVFFFCATSSQEMKRWLEAMEKAIRPVT
QTHVWEDVTRHNCSLPPLAVKSPECLGLLHKLDRSKDTWVQHYCILKDGCLSFYSGIRAT
HAQGGIYLQGYMVREQPYGSKKSSIELKPPSDEFKTFYFCAENATENKRWILALQASVKK
WLPLHQALQDYMDQPPEETRM
Download sequence
Identical sequences H2SVC5
ENSTRUP00000016363 31033.ENSTRUP00000016363 ENSTRUP00000016363

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]