SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000016429 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000016429
Domain Number 1 Region: 14-142,173-279
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.6e-76
Family Calponin-homology domain, CH-domain 0.0000356
Further Details:      
 
Domain Number 2 Region: 6966-7112
Classification Level Classification E-value
Superfamily Spectrin repeat 5.11e-21
Family Spectrin repeat 0.0043
Further Details:      
 
Domain Number 3 Region: 8048-8203
Classification Level Classification E-value
Superfamily Spectrin repeat 3.99e-19
Family Spectrin repeat 0.0062
Further Details:      
 
Domain Number 4 Region: 7829-7952
Classification Level Classification E-value
Superfamily Spectrin repeat 1.75e-17
Family Spectrin repeat 0.0047
Further Details:      
 
Domain Number 5 Region: 3335-3452
Classification Level Classification E-value
Superfamily Spectrin repeat 7.55e-17
Family Spectrin repeat 0.0075
Further Details:      
 
Domain Number 6 Region: 7420-7550
Classification Level Classification E-value
Superfamily Spectrin repeat 1.92e-16
Family Spectrin repeat 0.0068
Further Details:      
 
Domain Number 7 Region: 8370-8533
Classification Level Classification E-value
Superfamily Spectrin repeat 4.97e-16
Family Spectrin repeat 0.0067
Further Details:      
 
Domain Number 8 Region: 7087-7225
Classification Level Classification E-value
Superfamily Spectrin repeat 6.02e-16
Family Spectrin repeat 0.0087
Further Details:      
 
Domain Number 9 Region: 2679-2803
Classification Level Classification E-value
Superfamily Spectrin repeat 8.23e-16
Family Spectrin repeat 0.006
Further Details:      
 
Domain Number 10 Region: 4509-4666
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000675
Family Spectrin repeat 0.0074
Further Details:      
 
Domain Number 11 Region: 2404-2521
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000144
Family Spectrin repeat 0.0033
Further Details:      
 
Domain Number 12 Region: 3065-3177
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000816
Family Spectrin repeat 0.0054
Further Details:      
 
Domain Number 13 Region: 6756-6896
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000972
Family Spectrin repeat 0.0097
Further Details:      
 
Domain Number 14 Region: 5048-5207
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000177
Family Spectrin repeat 0.0074
Further Details:      
 
Domain Number 15 Region: 1441-1559
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000276
Family Spectrin repeat 0.0053
Further Details:      
 
Domain Number 16 Region: 5716-5809
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000615
Family Spectrin repeat 0.0069
Further Details:      
 
Domain Number 17 Region: 3763-3887
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000756
Family Spectrin repeat 0.006
Further Details:      
 
Domain Number 18 Region: 2251-2405
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000124
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 19 Region: 7956-8066
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000138
Family Spectrin repeat 0.0079
Further Details:      
 
Domain Number 20 Region: 3568-3701
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000209
Family Spectrin repeat 0.0079
Further Details:      
 
Domain Number 21 Region: 3890-4031
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000331
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 22 Region: 4291-4447
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000662
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 23 Region: 563-701
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000831
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 24 Region: 7736-7841
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000144
Family Spectrin repeat 0.0092
Further Details:      
 
Domain Number 25 Region: 8503-8637
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000304
Family Spectrin repeat 0.016
Further Details:      
 
Domain Number 26 Region: 2837-2948
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000312
Family Spectrin repeat 0.0085
Further Details:      
 
Domain Number 27 Region: 7343-7454
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000209
Family Spectrin repeat 0.0088
Further Details:      
 
Domain Number 28 Region: 5936-6068
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000118
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 29 Region: 4959-5079
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000302
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 30 Region: 4642-4774
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000504
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number 31 Region: 3177-3284
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000196
Family Spectrin repeat 0.0087
Further Details:      
 
Domain Number 32 Region: 7549-7668
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000023
Family Spectrin repeat 0.0093
Further Details:      
 
Domain Number 33 Region: 2110-2200
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000249
Family Spectrin repeat 0.0075
Further Details:      
 
Domain Number 34 Region: 1082-1223
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000266
Family Spectrin repeat 0.015
Further Details:      
 
Domain Number 35 Region: 1623-1748
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000466
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 36 Region: 1718-1870
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000681
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 37 Region: 1952-2081
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000107
Family Spectrin repeat 0.0058
Further Details:      
 
Domain Number 38 Region: 6550-6634
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000133
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 39 Region: 5532-5637
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000168
Family Spectrin repeat 0.0071
Further Details:      
 
Domain Number 40 Region: 4886-4997
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000183
Family Spectrin repeat 0.0054
Further Details:      
 
Domain Number 41 Region: 4003-4113
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000072
Family Spectrin repeat 0.0068
Further Details:      
 
Domain Number 42 Region: 4209-4336
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000144
Family Spectrin repeat 0.0077
Further Details:      
 
Domain Number 43 Region: 879-1015
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000192
Family Spectrin repeat 0.009
Further Details:      
 
Domain Number 44 Region: 3462-3552
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000705
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 45 Region: 6345-6471
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000892
Family Spectrin repeat 0.0093
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000016429
Domain Number - Region: 2517-2617
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000288
Family Spectrin repeat 0.006
Further Details:      
 
Domain Number - Region: 6680-6793
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000691
Family Spectrin repeat 0.0047
Further Details:      
 
Domain Number - Region: 6080-6197
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0012
Family Spectrin repeat 0.0093
Further Details:      
 
Domain Number - Region: 1310-1408
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0054
Family Spectrin repeat 0.017
Further Details:      
 
Domain Number - Region: 2598-2668
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00863
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number - Region: 707-804
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0138
Family Spectrin repeat 0.019
Further Details:      
 
Domain Number - Region: 4109-4210
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0245
Family Spectrin repeat 0.009
Further Details:      
 
Domain Number - Region: 386-505
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0537
Family Spectrin repeat 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000016429   Gene: ENSTRUG00000006690   Transcript: ENSTRUT00000016501
Sequence length 8783
Comment pep:novel scaffold:FUGU4:scaffold_227:27826:84377:-1 gene:ENSTRUG00000006690 transcript:ENSTRUT00000016501 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQRNNMASRRPLDIANVMQKLQGEQEAVQKRTFTKWINSHLAKCKPPLEVNDLFEDIKDG
VKLLALLEVLSGQKLPREQGRQLKRIHWVSNIGTALKFLEGRKIKLVNIHATDVADGRPS
IVLGLLWTVILYFQIEELTSNLPALQALSNSNSSVESIASSETGSPPMKRKVINKFQGNA
KKALLRWVQSTSAKHHGIEVKDFGPSWRDGVAFQSVVHAIRPDLVDMDVVRRRSNRENLE
EAFALAENELGIPRLLDPEDVDVDKPDEKSIMTYVAQFLKHYPNPQQSGPDGYHDEIKLL
LGSIPTFALSVPVLQREERKILRELKVFLDQLERDVLRAQGSEGNLTDKYQAFKSFSVQY
EMKKKQTDPLLQPVHRDGKLSVDQALVKQAWDRVSARLLDWHLHLDKSLPGPLGVIGAWL
HRGEMALREDFPIQQVPEENANVLHRKLEQHKEVLRNLESHKQTFQQIHKDRSVNGVPVP
SEQLQDMAERFNFVSTSSHSHLIKLEFWEMKYRLMAFLLLAEAKLKSWIIKYGRRDSVEL
LLQSYLTFVEGHRFFEQYEMIFAALKQVADVYVKSDSSIDEAEGVSKFLSDATAQWKNLS
LEVRSVRSMLEEVICNWEKHSSTVAALQAWLEDAEQMLNQSENAKRDFFRNLPHWVQQHM
DMNDAGNFLIETCDETVSRDLKQQLLLLNGRWRELFVKVKHYARADEVDKLRQDYQDGIN
TLKIFMDATNEKMTAPVQLSFLIIRAFVQDVEEIKHKVPAMEAACKAASRTAQLLTKDTP
QDEVSQMMAVMASIKEQLSKVRERCLPLLRDSVSLLPPLEEMERNITGFYQALEKASYIT
GTTDSEGPVDFKQRCQELATFTHSCKKCLAVIEKNHQTIQKIVHSNKTLQHMDMSLLQKR
VADLQVSSQTMIRESTEWRKHMEANSSLMKRFDESRVELEKSLKLAQNCLSERGNPEELL
KKHTEFFGQLDQRVLNTFLKACDELTDILPEPEQQALQETVRKLHKHWKDIQTDSPFHLL
RLKVEVEKGKLMVLLQDCQAELTRENRHLPSTGSERLIKEHRAFFKEKGPQAIFEKRLQL
MDELCQKLPEGDAAQQTLETARKDFSELQEEIESTNQKLMQHPDKWKEYNARYAEFSCWL
ISKESQLRLLRNRANDPRKYGQVKTAITELRNDAELQEGNLGWLKARMAVLIEISAESDG
QRQGSALGKLSADFKGLLASLSEAEKMMLAVEDCVQFKEEVKTTLDDLIQGQKEVQDEFV
KILDSPTVRDAQQLLLIYQQLSKRLKLKRKDVQQLITRGQQLQAEEGLGETLQQDLQCLD
NTISKMEQNMDSQEQSLEVTLAAWQEFDSQQEAVHEFVNKTQSTIDRDLSFSSPESLAVE
LDQTRVLLKQCEAEVSHMNTLLKRATEIQLGPKNKSLLLQQARSLSEQVDKVEAGLNKDI
KTLEEIKDHWDNFAGAFETFSLWISEKEKQLDGLQSSTLPLEQQINTVKIVDTEIQERAE
VLSQLETRSQALAQFMSSGEAAHIKARLTQIGRYWEELKESHQQLDGQLEERSSHQQKFK
ISLLEVQETLRDIDTNLEHPVKSSTSSAETYKGLQNHMDVFQNLEKLKGNLLSLSASARR
LCDKEQAEKTLAELNTSYEQSMERAKVKQSALENLFSLWQKYEKLRTNFISFLERSESAS
KQESNCLSADKSKLRTEIHDLQALHSEIQSFQLVHPELATLVNSLCPTASEERVQQLKDD
LGTLQKRLNFQNEVIPERIKELQNHLSLVEQFDQTLLKFSHWCDSILSSLNSPSQVSISD
LQLTFSQVKETQVALQKQFGARQTLEQQTEKLCQLCEPSDAQLLNKKVDSCLQPYVEAQH
ITEQQLECLERLEAFLHTHSVAAGVLRGLKQTVESAGSWDRGKVEELQQELATIVPDISH
LETLAVNLDSSLCKSHLHIGVDDGSRKSCRMLADTLSAELDAVKTLLGTKQSEAEALGAL
WTSFRQRKEQLLKAVEDIEEKADQQRLKEPTMHALQQRIKFFNQMEDELQSHQHEEQWLR
DKGHQLAQKDAELAGEVLRELSLLETTWEETKRLITERQEQCNTLADLLREYQILRTSII
SISEGAGHLSDISSVLKDHEGTRRSLAKHEAVKIEMASKQHELDVFSSRGKQLLSELLKI
PDCDIHIIKKDMDTLVDQWLDVSERIDENIDQLNQSLVLWDDVHKISDDIESWANNGLIE
LNEALNNLNDTQKVSERLSVLKVEMSEKEQKLETLQSKVSEVKKCSQSQETPAKLQILQN
DLCKKISTVHKLHDQVKANLTDFTFQRKQLEDYITQMSAWLKSMEDSLVSSPTGSDPEDI
CKVKDLQKELQNQQGSIDSTREGLNTLCRKYPSEELASLGSALTDLIKTYEFVNQLSART
LTSLQNCLQQQFIDQVQEFHRWLNEQKEIVKECSDRSGDTQIVERKLQKLKGAMDRVEEG
ELRLTQVCENGEKLLLHLPKASAGQVQQHLSSIQQDWDSFVKQCGQNQQILDDSASLMKG
FEGRLKKLRWWVENVEKRMTTDLLEAKQHGPEKAVLEQVEQYQQEILKERDSFERLCQEG
QALNEGGRGDGSETRVSAQLQSQHQALLRRVSQRVHTCQLTLQEQQAFEETLQTTWNWLN
GVQERLASLNSTIGNKETLEKRLGLVQDILLMKGEGEVKLNMTVGKGEQVLKHKGLEGQE
IISSQLQSLKDAWANMLMTSMSCHSRLEWTVAQWSSFQESKAQIQQWMESVEQEFGTTLP
QQPGLKEKCALLERFRAFQVDVDAHASALSRLTDKAVEMYEKTGDQSFGPDARAELSAHF
ADISAVVKAKVQSMQNIVSEHEQYLDALRDFNDWLTSAKEELQRWSDLSGDSVSIKRKLS
KVQELLDSKQRGRERLNRVQRFGAVARDHTGSGGYEAMEREEAALMSSWEQWERGALQTR
ASLESTLLHITNSEQELNRRSTQLEQDLQALSQQLQDCHVCLSQAENKNNGEEAVKGWQI
AKDTLDELGKAEPITENLKTQLNDLCRFSRDMGAQSDRVSAVIKEYNSLSLQASRECQSK
QKQLEQGFRSAFREFQQWLVNAKINTAKCFDVPQNLNEASASLLKIQEFLSDREQGQSKL
NAVLVSGELVCNVTAKEKVEAIQAKMNTAKEDWKNLMTNLHNRETGLQNLVSQMENFEAC
AEPLQDCLNATEQVVQESSTRLHDLTGKKEELHKLQSVLEELASLEIQLNKLREKAQLLW
DEHAAGKGFVHRVAQLSAQYLALTNLTKEKASRIDRIVSEHQLFSQGLKELQNWVADTSH
MLHTYCAPTADKNILDSRMIKLEALLTARQEKEIQLKMLITRGESVQRNTSAEGVPVVQK
QIQDLKDSWDALLSVSIHCKSQLEGSLSQWTSYQEDVRQFVAWLEHVEESLNPAEKHCPE
MRDKTANLSKAKLLYEEVLSHNTLLDTITAKSACISENFVTQLELQDLQERYNAVKDNAM
RAVGKAEELVKAHQEYQHGLHTFEDWLEEEQEKLGCYTQLEGEVELLEETLQKLQELQCH
CTEGQALLNTLLVSRELVIPWGLPQIEDRRLETLQQEWRLYQAQLVDTRGQLNSSLAKLR
QIEQKFQCLDSWLKGMETKAQLRNNRQSDRATKDAQLQLIKSWQEEVMVYQEEMEGLSLL
AQQVMDETHISSQISTRATKITARYHILLLHLLETIKQLQEELSCIDEAQSVFTIFSEWL
NTVQKNFNTVAVPINAVERLPMEKKMKKLEALQTDMEQGHIYLKTMKEKSEKAMAFLEEP
EAGQLRDEVDTYFLQLQELMDTLRTEHSSLEKCISLSKDFLDKYKAQAQWLIETKNFLLS
SVEPKAELYQKKAQLAKYKTIQQTVQSHESALKSVFEKGQALLDIVHDTTISDNIKKMQA
DYQDICLAAKTQVQNFVEWVKEHEDYNSELQEVEKWLLQMSGRLVTSDSMQTSNMEMATQ
QLARHKALMEEITSFEERLINLKLKGDDLVASCTAQVQARISHQVQSHQQGTRDSYSAIC
STAQRVYQSLDRELQKHVSHQDTLQQCETWLITVQEELQSNDQGPSGLQEALKQVKQYRA
LQEQASTYLDLVCSVCDLSDDAVRVAAAQVQQIKLTIEERMSNAQELSEGWREIKEQKQE
LTNFFQDVEQQLLSFSRRPAELETKIAQNMLSQVKEYSHQLETKQNILTKMKETVRKLTR
GQDSPEHAEIDHLSHSWLELCHQAKKLQMQREEDLQRSSEYHDCIGAVEALFEQVSKEWD
SLARTDAESSSQHLEALRKLAASLEDQKSTLEDLKEQKQKVIQYLNLDDKELVKEQISHF
EQRWSQMQSLIERKIQDSVMTFEDMAQIEARLKEAREWAEEQQPALSEAMKMSPPPELAQ
SFLFDHLSICSELEAKQLLLAQATADADRVLARLGLSERQHLQQLITDTQNEVESLSVKV
AQRRKHLSKAFTERTQFLMAVGQSISWVQQNEKKAQAEEYIALLPEDLAKQVRTCRNIQS
SLKAYQSELTSLWSQGRDLMRDASEEERNEILTKLQELQNIFDKTLHRCGQKLQELEKVF
VSRKYFKSDLEKICLWIKQADIVTFPEINLMVGDPELEMQLLKYQHIVEQAVEYENLLLI
VQRAGQEILPSLNEVDHCYLDEKLNSLPLQYNSILALAKEKQEKIQQAILTRNEYTSFID
VTYKALKELEEQFNTLSIQPGGLHTEEVISLQNDYKAIQTDLSNLGLAVSELNQKKEAFR
STGQPWCPEEMTQLVSLYNGLKRLIEQKVEHLDETLESFEDHKAMALQMDSELKATKEQL
VKVNAETQSAEERLKNYHALAGSLQSANSHLSRLMEQMDSLAPRVDQAAHDASKEQVVLW
QEELRSLQSAVGELIEECEIRFVQSKDFETEMKRTLDWLHQVRDELGSGVIVDVRVEKVQ
EEIRKQQIMQEEVQSRLRIVASLSSREKQKYVSVNELVPEHVDTSLEEMAKLQADVQKAL
SSRQITLEDALVLCQKYHFRMQSACEWLEDAVSFLQQASLGVDVENYEECLRQQLDIMAT
EQEFLIHLDELQALVPHLESIVNPVAKEQLHISVESARQRGVEVRDQLHCHQDVLHSCVA
QWKSYQEARQTVIELMNEAEKKLTEFSTAKAATSQEAEDKLCSHRSLVSLVNGFQEKLSG
LEEQAAKLELVASDASKATISRSMTTVWQRWTRLRSVARGQESVLEDTAQEWRTFRDKMK
KVRAVSDELHSRFPDTSVEKASKATLQSLLDQHDFLSQDLERELSSLTLLRQYALSLLHD
VEVPSPTNEQDELPGLKEIRCVQDKMESLLTQSRTQRAHAVQELRDRDEVEKELSVVKVW
IQETRELLLNPTQDIDFLLQELEVVHGDVITYRQNVDKLAEQQQSKYLDLYTILPSEISM
QLAEVSLALGAIEDQVLSKEREIQRTKEINEDISSQIHDVSEKLRAVSVKFKEKSPDVDH
AKEEVKSLSENLEGCGCVLAELDSAVQDFGRRNPLLAKQLSDSISKLSEMHHNSSRLADC
RNNWIKKAVCYIDEYNEMLDFIIRWSEKAKSLLRANIIWNSSGHLQEQIRLCQAVLRESR
ELHGDLESMAEKVELLSEVLQVESMSQQVCELSRHTEELQQSIKMRLQSLEDANKTMEAL
EYEVKALQIALEQVQATLTSPELARQSLKEQLFQRQRLLADMESLKQQVQAVQMCQSALQ
VPEEVMPNLAICRTALRLQQEASQLQHVAIQQCNILQEAVVQYEQYEQEVKDLQSLIEEA
HRVIQDRPIPTNNIQELQAQILHHEELAQKIKGYQEQIASLNSKCKMLAVKAKHATMLLT
VSDIEGQPEMDEEESQKYSAQATTPVAISQMTAGRCHTLLSPVTEESGEEGSSSEVSFSP
ICRSPPFNRTEVTVTFLDGHLCQCNSSHKYSGFKKCNASMMEAKELYDPNFESVANLDDL
QRSWESLKNVINEKQRSLYEALEKQQHYQGSLQSISSKMEALEAKLSEPLEVDISPDSHI
KAHEGLLGEIQIVQDEINKLQEEFTEDLATSSVDSGDQLAMQSSLTVLAERMATIRMKAS
GKQQLLEEHMSDHLEGQRQEHAIHRYHTQADELERWLIRMRNAVICSLELRSQEKADMED
QLDECQNMLLEIEEKVLALSELSIHSENLLLEGRTDMREDAELLTRRLRTLKGGLLELQK
MLQDKQMNIQGSLQQQEESDSDSSLSQSPSVQEWVAQARSTRSQQQEDSLQSQRELEEQL
AEQKKLLQSVASRGEEILIQQASPTVTSSTDPFSSVAVVERESQADQDQMRQKWESLRLE
LKTKLQLLQKNLEKDHKLQVYSRPSCVTTSASLFREESQVDKSSLKTLFNNFKQTVEDMP
SQASDESQLPQMEQQLYVAVSSTSSWLDGVENIVLSGPMLLPENAETYLQEQETLENEVK
LVVEDVKLSKALLSGTSGLKPEDRALIEGNLDGLKDRLGALGCVLEKRCDHIKTRTHELT
AYQTKLQVLQTSLIETKCQILQALAGAMDRPASKQLEVIGNAEESLKDFEQKITELKTKG
AVLQADQMSTNKILKLQDSYEELVMMVGSRRSGLNQNMALKEQYERALQDLTDLVDTAKD
KMAADKRIVASSVEEVQHHLDKHKEFFQGLESHMILTEAYFRKINALMLPKERQALEDTL
DEAQTVIKKAHGKGVELECILETWCQLVQDYQNLNRHLEAVEGNVPIVGLVEETEERLMD
RITLYQGLKGKLTEHQHKLYQVLDEGKHLLVSVCCPSLENQLALLGEHWLNNTSKINNEL
QRLEAILKHWTRYQRENAELSQWLQSALERLEFWNTQAILVPQELETVRDHLSAFLEFSK
EVEGKSSLKSAVVTEGNQLLRLKKVDTVVLRSDLARIDTQWTELLTRIPVVQEKLHQIQM
EKLASRHAISELFNWISLMENVTQEDEENLKSAVGSNVIQDYLQKYKGFRVDLSCKQLTV
DFVNQSVLQIGGQDMESKRSDKTDFAERLGAMNRRWQILQGRINERIQFLEGLLEMWFEY
ERSVQALKSWMANQEERLKKKHRMEDLTSVQNALKECQEMEELVKEKEKELERVEEQGCA
LVQNKTDEACAIVMETLQGVNHTWANLDHLIGQLKISLKSVLDQWSLYKQASEEINGYLM
EGRYSVSRFRLLTGSLEAVQLQVQSLEELQEELEKQESSLRKFGALTHQLLRECHPSVSN
SLNNTLTDVNARWSCLLEEIVERLRSSKALLQLWQRYKELFEQNCSNIQLQEEMADKLLK
HACSKDIADKELSDWIEECSDVLRAQAPLQASLQVLQELGDQLKQQVDTSAASALQSDHV
SLTHRLAAVEHALTRQLTTLQTGVQDYEIFNEQLDSLGSWIVKAEEALEIQDPNGSTEST
VVQDRMEELKKLMLKFSSMAPELERLNELAYRLPLNDAEIKRMQNLNRSWSTFSGQTTER
FSKLQSFLLQQQTFLEKCETWMEFLVQTEENLAVEISGNYQSLMEQQIAHELFQAEMFSR
QQILHSIISDGQRMLEQGQVDDRDEFNLKLALLSNQWQGVVRRGQQRRGIIDSLIRQWQR
YREMVEKLQRWMVEVSQPAEALQSGATVPLQQARSMLDAVQLKEKVLHGQQGSYILTVEA
GRQLLLSADSFAEGDLQVELTGIQEQWKHASSHLEEQKKALTSLLKDWERCEKGICGSLE
KLRAFKRQLSMPLPDHQEDLQNEQMRCKELENRFDGWTGDLAHLSVLRESLSCYISAEDL
SVLQERTELLHRQWDEICHQLSLRRQQITEKLNEWAVFNEKYKELCEWLTSMEGKVSQNG
DISIEEMIEKLHKDYQEEIKVAEENKLHLHQLGERLARASHKSKALEIEQKLNKVGDRWQ
HLLDLIGARVKKLRETLVAVQQLDKNMNSLRSWLAHIENELSKPIFYDSCDFPEIQRKLD
LQQELQRDIEKHSTGVASVLNLCEVLLHDCDACATDAECDSIQQATRSLDRRWRSICAMS
MERRLKIEDTWRLWQKFLDDFAHFEEWLAISEKTASRPNSSGVLYTVAKEELKKFETFQR
QVHESLTQLELINKQYRRLARENRTDASCHLREMAHNANQRWDNLQKRVASILRRLKHFI
NQREEFETARDAILVWLTEMDLQLTNIEHFSECDIQAKIKQLRSFQQEISLTTAKIEHIF
HQGETLIEKSEPLDAAVIEEELEELQRYCQEVFGRVERYYKKLIRLPLADDDTEVSLSDR
ESELDEPGDLSSIPWNERLGDGFLSPLPSSGRSASLAAQLRTERSGRDTPASVDSIPLEW
DHDYDLSRGLESASRALREQQSEEGDFLQRPSSSLSGEVASTDSNIHPLDATRFHLQQLE
GSRSRTPTSTETDASYMGYMRLLGECRGSIDAVKKMGFELKEEEDTVSGLADPSSSESQT
SGVIERWELLQAQDLSKEIRTKQNQQQWQQLNSDLNKIWAWLGQTEEELEQQQRLELCTD
IQTIEQRIRKLKELQKAYDKRKPIVLSINLCSNEFVQTDTAESRELQAKLKDMNKHWDRM
GSSLEEWRSALQEALMQCQDFHEMSHGLLLWLENIDRRRNEVVPIDPIQDSDTLHEHHKT
LTQIRQELLDSQLKVASLQDMSLQLLVNSQGSDCLEAKEKVHVIGNRLKLLLKEVTRDLR
ELARILDITSSQQDLSSWSSADDLDTSGSLSPVSGRSTPSRRRSQRGKCSRSQPGPSVSG
PHHRYPSGAGSVSFPSDAEAPRQRGGFLRRVLWVALPLQLLLLLLVVFAFLLPMSEEDYC
SQTNNFAHSFYPMLRYTNGPPPV
Download sequence
Identical sequences H2SVJ1
31033.ENSTRUP00000016429 ENSTRUP00000016429 ENSTRUP00000016429

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]