SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000016523 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000016523
Domain Number 1 Region: 80-257
Classification Level Classification E-value
Superfamily EF-hand 1.89e-47
Family Calmodulin-like 0.000000516
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000016523   Gene: ENSTRUG00000006718   Transcript: ENSTRUT00000016595
Sequence length 261
Comment pep:novel scaffold:FUGU4:scaffold_84:89387:95238:-1 gene:ENSTRUG00000006718 transcript:ENSTRUT00000016595 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ASRSQEDEKAVDGGMVPDAKGKDPNQGEQTDGSKWQRPRLTRKSLMKCCLVKWIIASTTQ
QGPGTDTCEGDLELSMVRHQPEGLDQLQAQTQFTRKELQSLYRGFKNECPSGLVDEETFK
NIYSQFFPQGDATMYAHFLFNAFDMDRSGSIRFEDFVIGLSVLLRGSVPEKLRWAFNLYD
INKDGYITKEEMMAIMTSIYDMMGRYTLPTIRDDSPFEHVEKFFQKMDRNRDGMVTVEEF
IETCQKDENIMSSMQLFEHVI
Download sequence
Identical sequences H2SVT5
ENSTRUP00000016523 31033.ENSTRUP00000016523 ENSTRUP00000016523

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]