SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000016527 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000016527
Domain Number 1 Region: 34-331
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.76e-51
Family Nitrogenase iron protein-like 0.00082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000016527   Gene: ENSTRUG00000006720   Transcript: ENSTRUT00000016599
Sequence length 349
Comment pep:known scaffold:FUGU4:scaffold_62:178875:181914:1 gene:ENSTRUG00000006720 transcript:ENSTRUT00000016599 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VAPFLVGWTLLEDEFEDAPDVEPLEPTLKNIIEQKSLKWIFVGGKGGVGKTTCSCSLAVQ
LAAVRESVLIISTDPAHNISDAFDQKFSKVPTKVKGYDNLFAMEIDPSLGVAELPDEFFE
EDNMLSMGKKMMQEAMSAFPGIDEAMSYAEVMRLVKGMNFSVVVFDTAPTGHTLRLLNFP
TIVERGLGRLMQIKNQISPFISQMCNMLGLGDMNADQLASKLEETLPVIRSVSEQFKDPE
QTTFICVCIAEFLSLYETERLIQELAKCRIDTHNIIVNQLVFPDSERPCKMCEARHKIQS
KYLDQMEDLYEDFHIVKLPLLPHEVRGADKVNAFSKQLLEPYKPPSNTP
Download sequence
Identical sequences H2SVT9
31033.ENSTRUP00000016527 ENSTRUP00000016527 ENSTRUP00000016527

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]