SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000016586 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000016586
Domain Number 1 Region: 81-344
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.15e-75
Family PAPS sulfotransferase 0.000000113
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000016586   Gene: ENSTRUG00000006751   Transcript: ENSTRUT00000016658
Sequence length 345
Comment pep:novel scaffold:FUGU4:scaffold_229:429530:430839:1 gene:ENSTRUG00000006751 transcript:ENSTRUT00000016658 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLFKQQPLLTQKLFVLGSLAIGSVLYLVARVGTLDRLQPICPIERRLPPPEHEQIPLRTL
QFKRGLLHELRKGNATKEQIRLHNLLQQLPQAIIIGVRKGGTRALLEMLNLHPAVVKASQ
EIHFFDNDQNYARGIEWYREKMPFSFPHQITIEKSPAYFITEEVPERIFKMNSSIKLLVI
VREPTIRAVSDYTQVLEGKERKNKTYHKFEKLAVDSGTCEVNTKYKAVRTSIYTKHLERW
LKYFPVDQFHIVDGDRLIADPLPELQLVERFLNLPSRISQYNLYFNATRGFYCLRFNIVF
NKCLAGSKGRTHPEVDPSVVTKLQKFFHPFNQKFFQITGRAFNWP
Download sequence
Identical sequences H2SVZ8
31033.ENSTRUP00000016586 ENSTRUP00000016586 XP_011616775.1.43653 ENSTRUP00000016586

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]