SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000016651 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000016651
Domain Number 1 Region: 9-404
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.52e-118
Family Motor proteins 0.00000117
Further Details:      
 
Domain Number 2 Region: 1334-1640
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.02e-38
Family Quinoprotein alcohol dehydrogenase-like 0.028
Further Details:      
 
Domain Number 3 Region: 982-1100
Classification Level Classification E-value
Superfamily Prefoldin 0.00000000628
Family Prefoldin 0.021
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000016651
Domain Number - Region: 476-558
Classification Level Classification E-value
Superfamily Prefoldin 0.0012
Family Prefoldin 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000016651   Gene: ENSTRUG00000006777   Transcript: ENSTRUT00000016723
Sequence length 1646
Comment pep:known scaffold:FUGU4:scaffold_273:284630:302700:1 gene:ENSTRUG00000006777 transcript:ENSTRUT00000016723 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSGPDESSVRVALRIRPQLAKEKIEGCHICTFVMPGEPQVVLGKDKAFTYDHVFDIDTQ
QETIYQHCTGRLIEGCFEGYNATIFAYGQTGSGKTYTMGTGFDVNIGDDELGIIPRAVNH
LFRGIEERKQAATVQGRPVPEFKINAQFLELYNEEVLDLFDTARDPEARKQRSNIKIHED
ANGGIYTVGVTTRTVTSAAEMIQCLKIGALSRTTASTQMNVQSSRSHAIFTIHLCQVRVC
APDNNETVTDNRLASNSDISEFETLTAKFHFVDLAGSERLKRTGATGDRAKEGISINCGL
LALGNVISALGDRSKRSTHVPYRDSKLTRLLQDSLGGNSQTMMIACISPSDRDFMETLNT
LKYANRARNIKNKVMVNQDKASQQISALRTEIARLQMELMEYKTGKRMVGEDGMEGINDL
VHENSMLQTENNNLRVRVKAMQETIDAQRARLTQILSDQAYQVMAKAGEGNEEIGNMIQN
YIKEIEELRAKLLESEAVCENLRKSLSRASTRSSLYGGPGSFSSALVVPEKEANEVIEMA
KRNLEKLKKIKKKKKKRRLRRYEESHQHWHAEGPRFAPVDQIQNTNKEEAPDNEQEQSNE
DVAEFQEGSDHDEAEDADAEEDEYDLAGDETSEDSDSEELDEKEDVQADLANITCEIAIK
QKLIDELENSQRRLHTLKQQYEQKLTMLQNKIRDTQLERDKVLHNIGSVESGMEEKAKKI
RVEYERKLSSMNKELQKLQSAQREHARLLKNQSQYEKQLKKLQMDVTEMKKTKVALMRQM
KEQQDRNRAAESRRNREIASLKKDQRRAEYQLKQMEAQKRQQEMMLRRKTEEVSALRRQV
RPASGTVSRKVSLPETSHKPTQGRMSASGVASSNGARCEITFFYKISLSCVFFLFFLKSC
FSIRNSSVRMGSVYLTRTARTKWQSLERRISDIIMQRMTISNMETDMNRLLRQREDLTKR
RERVSRKREKMAAEGADADRSLASLNEELESLGANIDYINDSIADCQANIMQMEEAKEEG
DTVDVAAVISSCSLSEARFLLDHLMNLAINKGLQASQKDSQLKVMAGRLKQTEINSATQN
QLLFHMLKEKAEINPELEALLGNALQGLSIQSIENGEDSSSDESTPSPAAEGSTLASDLM
KLCGESRQRNKARRRAATQMELLYASSGDLSCEVPGGDFPSPLPSLSEQREGLSDTRGQT
SGQLQERERAVSPSPLTARPVTLSGARSPTGPERRQMERSPLSRRKQTTPTTIAATHTPS
VSTAEAVAKSSNYQSPNLHYLKAIGNVALLQQQRFSDELTENLTAMICHRGVINPVTTTK
TSRATKLQCVYIAEGHSKPVLCVDATDDLLFTGSKDRTCKVWNLVTGQEIMSLSDHPSSV
VSVRYTSSLVFTVSTAYIKVWDIRDSAKCVRTLTSSGQVGSGDTTSSVRSFSVPPGESQI
NQIALNPSGYFLYAAAANAVRMWDLRKFASTGKLTGHLGPVLCLAVDRLGSGQDVVLTGS
KDHHIKMHEVGEGTQGSIGSSHTFEPAHQDGVESLTVHRDVFFSGSRDCHIKKWDLASKQ
LLQQSSGTQGDWVSALGVVPGSAVLLSGCRGGLLHLWHADSLAPLGEVRGHDSPINGLAT
NSNQVFTASDDRTVKIWEAKGSLEEG
Download sequence
Identical sequences H2SW63
ENSTRUP00000016651 ENSTRUP00000016651 31033.ENSTRUP00000016651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]