SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000016761 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000016761
Domain Number 1 Region: 485-670
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 7.46e-52
Family DBL homology domain (DH-domain) 0.000000231
Further Details:      
 
Domain Number 2 Region: 677-803
Classification Level Classification E-value
Superfamily PH domain-like 1.21e-32
Family Pleckstrin-homology domain (PH domain) 0.0000121
Further Details:      
 
Domain Number 3 Region: 164-310
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000158
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 4 Region: 883-939
Classification Level Classification E-value
Superfamily SH3-domain 0.0000508
Family SH3-domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000016761   Gene: ENSTRUG00000006824   Transcript: ENSTRUT00000016834
Sequence length 949
Comment pep:novel scaffold:FUGU4:scaffold_219:151267:157572:1 gene:ENSTRUG00000006824 transcript:ENSTRUT00000016834 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSFQTSFPGNLHLILVLRPTGLSSTTPSPSSSTDLGFRFSQDDFLLKMPVVMLRSVGELL
RYIDENHLASDFTAKVEYCQSDWIVLRTAIETFAVTVKEIAQVLQGFGSELSDTELPDEA
STIEFLLHSHTHRYRQMKDDIRKVLKEGRLLLTNLETVKASKRDVEEERDIGGDMDTVQR
LLGQLRDMEEAFDGFFEKHHLKLQQYLQLLQYELSFHQMEEVLKRLSDQERAVGFVGSTV
VQTEQLLRDLEVLDTQAREEMARAQMVILHGHQLAANHHYALALIVQRCNELRHLCDVIT
TAMRAKRASLTRARDLLRRLEGALRWCDEGAYLLASQMVDKFQTKEGAQEALQILNTHQE
RAPSALKNSQGILSLEFEAILTPQLQSQISMVTEKLNMVQSMIRNREQCLRKLADMQVRP
VQLVAPRPELDQISQRCKSPLFSPKHGMTSHFSTDSHDNRSCLYGPVPETDSETEDNPEQ
VTRIPCLHSHIMKELIATERIYVDELLSVLLGYRAEMEDPAMSDLLPSALDSQKDLLFGN
MPEIYQFHSRVFLQDLQGCLETPEMVGSCFLQRKEKFQVYERYCQNKPRSELLWRRCCDS
PFFQECQKKLDHKLGLDSYLLKPVQRLTKYQLLLKELLKHCTEDRYRCELQEALDSMLKL
LKSVNDSMHQIAITGYPGDLGQLGRVVLQGGFSVWISHKRAAVRMKEMARFKPMQRHLFL
YDHALLFCKRRDDDNPDRTPFYSFKSCLRMSAVGVTENVKGDVRKFELWYSGREVVYMVQ
APTLEVKVTWLTEIRKVLSNQLKLRQGHKTCLPVPHSSTATSHSYRNREEESTNTSSAHS
DPVVHSPRRTWPVPAHSVAICEGLEDWGAATDFSNISDSDEEDQPAPLVAGRYRVMVQSS
MASADDISFNCGDVIQLLQEEMSGMWMVRNISRGEEGRVMSEDLHRILG
Download sequence
Identical sequences H2SWH3
31033.ENSTRUP00000016761 ENSTRUP00000016761 ENSTRUP00000016761

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]