SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000017329 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000017329
Domain Number 1 Region: 7-176
Classification Level Classification E-value
Superfamily E set domains 1.75e-78
Family Arrestin/Vps26-like 0.000000186
Further Details:      
 
Domain Number 2 Region: 178-402
Classification Level Classification E-value
Superfamily E set domains 9.33e-60
Family Arrestin/Vps26-like 0.0000000643
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000017329   Gene: ENSTRUG00000007052   Transcript: ENSTRUT00000017403
Sequence length 417
Comment pep:novel scaffold:FUGU4:scaffold_275:269364:275330:-1 gene:ENSTRUG00000007052 transcript:ENSTRUT00000017403 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDKPGTRVFKKTSPNSKLTVYLGKRDFVDHLTCVEPVDGVVLVEPDYLKDRKVFVTLNC
AFRYGREDIDVLGLSFRKDLFVSTVQVFPPVEKVQKDLSQLQERLLTKLGQNAHPFTFTI
PKNLPCSVTLQPGPEDSGKGCGVDYELQAFCAKTADEKLHQRNSVHLVIRKVQYAPETPG
PQPMVETRRNYLMSDRSLHLEASLDKELYYHGEPISVNVHVSNSSVKTVKKVKISVRQYA
DICLFSTAQYKCQVAHLEAEDQVSPSSTSCHVYTLTPLLGNNREKRGLALDGKLKHEDTN
LASSTIIKEGANKEMMGIFVSYRVKVKLVVSLGGYLKHSYCDVTEKDVAVELPFVLMHPK
PAHQPSAQQQPAAVSVSVDTNLIELNTSTSSDGGDLVFEDFARLGLTGTKDNQDRED
Download sequence
Identical sequences H2SY41
ENSTRUP00000017329 ENSTRUP00000017329 31033.ENSTRUP00000017329

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]