SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000017383 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000017383
Domain Number 1 Region: 1029-1157,1341-1527
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 6.67e-45
Family p120GAP domain-like 0.017
Further Details:      
 
Domain Number 2 Region: 620-712
Classification Level Classification E-value
Superfamily E set domains 0.00000000000001
Family Other IPT/TIG domains 0.02
Further Details:      
 
Domain Number 3 Region: 711-810
Classification Level Classification E-value
Superfamily E set domains 0.00000000000019
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.092
Further Details:      
 
Domain Number 4 Region: 53-105
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000523
Family Plexin repeat 0.0024
Further Details:      
 
Domain Number 5 Region: 537-623
Classification Level Classification E-value
Superfamily E set domains 0.000000000154
Family Other IPT/TIG domains 0.017
Further Details:      
 
Domain Number 6 Region: 9-55
Classification Level Classification E-value
Superfamily Sema domain 0.0000262
Family Sema domain 0.018
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000017383
Domain Number - Region: 824-876
Classification Level Classification E-value
Superfamily E set domains 0.0187
Family E-set domains of sugar-utilizing enzymes 0.031
Further Details:      
 
Domain Number - Region: 208-242
Classification Level Classification E-value
Superfamily Plexin repeat 0.0331
Family Plexin repeat 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000017383   Gene: ENSTRUG00000007076   Transcript: ENSTRUT00000017457
Sequence length 1560
Comment pep:novel scaffold:FUGU4:scaffold_215:188976:199718:1 gene:ENSTRUG00000007076 transcript:ENSTRUT00000017457 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVLVEPDLSGHLYGSLLVDSGSSINADLLLDQSQQHIYVLTNSRLSKVPVSSCERQTDCQ
SCLAVRDPYCGWCVLEGRCSRKQQCQRHSQPNQWFWSFEATSQCVNVQNLQPASQSRAEQ
NQVTLSVVQLPVLTEAESLSCVFGLLPPQPAVVTGTSITCQSPVPELLPPMPTGSDHMIL
PVSLVFGHVTIATSNMTFYDCGAVSRLNQSSQCLACVTSVWRCNWCPLDQLCTHNHSCPN
QHVILSQRVRQPVSLSLRPSVCLSVPLSVWCTFCHPPPGVKHFTPLMCPVHVPVPAGVSR
SHVLSSGVWAAKFCLSAFRHDHQFGAARKKPGRLHCEADFCSGVTTVAVSLCERVKTHET
GPLNGSAGLKLLQDSLEQKGLPKRMKPRMSVLWKSKESSTDWPPLWRSHMTTQTPSSAAH
TSQLQYSVPIYLCRGERRIDASPGLRRECVCWMRVCVCVCVCVCVCCRNVTNLYLLPCLV
QLYDCSAGQSDCSQCRAVPEEYGCVWCPGSPSPGCVYNQSCSRTPEDSWPTSSDYTVQPL
SGPLEGGILVTISGSNLGMIHDVVGGITVAGVPCPPQAEGYHISTRVVCELQPSGKQREG
PVMVRVGAAPPGESRQVFTYQDPQILSLVPDKGPVSGGTQLTIRGQQLLTGQKSDLRAFL
GVQSCYSLEEVNDTHLVCQTASSNQTGGVVVRVLFGKAERTIGSMKFRYLDDPVITEASP
AESFYAGGRVIMVTGRNLDVVQQPILAVWVEPVEVQRVMERCSILSSSQMTCRTPEVSAD
FKIKGVWFQMDNVRIHFESIKGQSFTYYPNPDFFRLNREAPNAPYRFKPGGVIAVEGQDL
TRAISRQEVTARLGNEECEVKTLDNTHLYCEPPEVQPMSVDDGSELPSLKVFMGNLQVDL
GLVQYDSDSLLSPVPLAAQIGLAGGAAIIILSVLVVILMYRRKSKQALRDYKKVLVQLET
LEINVGDQCRKEFTDLMTEMMDLSSDVGGPGLPLLDYKTYAERVFFPGQHVAPLTRQLDL
PESRRQTVEQGLQQLNNLLNNRLFLTRFIHTLEAQQGFSQRDRGYVASLLTMALHDKLEY
FTEVMKTLLQDLVQQYVAKNPKLMLRRTETVVEKMLTNWMSICLYSFLKEVAGEPLYMLY
RAIKYQVDKGPVDSVTGKAKRTLNDSHLLREDIDYSAMTLTVLVKNGVEVQPCPVKVLDI
DTITQVKDKILDQVYRGAPFSQRPAADSLDLEWRSGQAGHLTLSDDDVTAVVHGRWKRLN
TLQHYKVPDGATVALIPRSQSSGGVGVNQVFQTGEKTPMLEGEEEEGLRLWHLVKSSEDP
DIPKHRKSSMRDRERAKAIPEIYLTRLLSMKGTLQKFVDDVFVAILSTKRPPPIAVRFFF
DFLDDMAEKHGIDDPETVHIWKTNSLPLRFWVNILKNPQFVLDVQVTDSIDAVLSVIAQT
FIDSCTTSEHKVGRDSPVNKLLYAREIPRYKQLVERYYSDIHSAASGCYQEMNSTLTELS
GSFASEMNNLVALHELYKYINKYYDQIIMSLDEDSSGQKMQLAYRLQQVAALVENKVTDL
Download sequence
Identical sequences H2SY95
31033.ENSTRUP00000017383 ENSTRUP00000017383 ENSTRUP00000017383

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]