SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000017439 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000017439
Domain Number 1 Region: 36-137
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000153
Family Filamin repeat (rod domain) 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000017439   Gene: ENSTRUG00000007099   Transcript: ENSTRUT00000017513
Sequence length 510
Comment pep:novel scaffold:FUGU4:scaffold_83:569602:573637:-1 gene:ENSTRUG00000007099 transcript:ENSTRUT00000017513 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQRTVMSLHISLRLLLLFCLEGSRRGQPGAQADEVPSASKTLVWGPGLHANIVLPARFFY
IQAVDSSGRNFTTSPGEKTFEVKITSPGEHLTRIWLQVLDRKDGSFLVRYRMYSTYPEIH
IHILLKNEHVTNSPFILEGPVYHEGCDCPQPSGPVWEAHMRCPDSFPQIDRDLSAFPNVD
PDRIAQEIPQRFGQRQSLCHYTVKDNKVYVTTFGEHVGFRIFTDSILLSLTRKVWLPDVE
FFVNLGDWPLEKRKLTDKIHPIFSWCGSNNTQDIVMPTYDLTESVLETMGRVSLDMTSVQ
ANTGPPWAEKNATAFWRGRDSRQERLELVKLSRAHPDMIDAAFTNFFFFKHDESLYGPLV
KHVSFFDFFKYKYQINIDGTVAAYRLPYLLAGDSVVLKQDSGYYEHFYNELRPWEHYIPV
RADLGDLLDKIRWARSHDEEVKKIALAGQQFARNHLMGDKILCYYYKLFKQYAQLQITEP
QVRQGMERVEQPTDDLFPCSCHRKRVRIAL
Download sequence
Identical sequences H2SYF1
ENSTRUP00000017439 ENSTRUP00000017439 31033.ENSTRUP00000017439

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]