SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000017976 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000017976
Domain Number 1 Region: 6-174
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.66e-54
Family G proteins 0.000000113
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000017976   Gene: ENSTRUG00000007293   Transcript: ENSTRUT00000018050
Sequence length 195
Comment pep:novel scaffold:FUGU4:scaffold_68:388092:391211:-1 gene:ENSTRUG00000007293 transcript:ENSTRUT00000018050 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KMAIRELKVCLLGDTGVGKSSIVCRFVQDHFDHNISPTIGASFLTKTVPCGHELHKFLIW
DTAGQERFHSLAPMYYRGSAAAVIVYDITKLDSFQTLKKWVKELKEHGPEDIVVAIAGNK
NDLGDIREVPMKEAKEFAESIAAIFIETSARNAVNIEELFQKISKQIPPLENPEVESNDS
FKLTRAPAPSTRRCC
Download sequence
Identical sequences H2SZY8
ENSTRUP00000017976 ENSTRUP00000017976 31033.ENSTRUP00000017976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]