SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000017999 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000017999
Domain Number 1 Region: 60-361,534-569
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.2e-47
Family FAD-linked reductases, N-terminal domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000017999   Gene: ENSTRUG00000007302   Transcript: ENSTRUT00000018073
Sequence length 605
Comment pep:novel scaffold:FUGU4:scaffold_134:263484:266795:1 gene:ENSTRUG00000007302 transcript:ENSTRUT00000018073 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWFLVLLACVAIWVGGTYWYLFGKRSPFSLESLRPPGPREFDQKKRDKVLKQSFSLDKVP
QNLDVIVIGSGIGGLTAAATLAKAGKRVLLLEQHDQAGGCCHTFIEKGFEFDVGLHYIGQ
LHENSLLRIAFDQISEGQLEFQKLRQHFDTIQIGLGEEMCEYTVLSGKTEMKQHLLKQFP
EDTEAIETFFQIMKTSAKKTHYLATLKLIPQWVSLFLLKSGIANFFSPVFRLSGTCATDL
MNSLTTNKDLQVMFSYLFYGVPPKDSSILINALLVHHYKRGAYYPKGGASEIPFHIIRTI
QKYGGNCLVRAPVSQILVNEQGTAYGVKVRKGTEEVAVHAPVVVSNCGIFTTFQTLLPPE
IKDRPDVQERLNMMKHARGSFLIFSGFDGTEEELGLTSTNFWMFKNNDMDKSMEHFFSLS
KEEAPDNIPMMFITMPSSKDPEAKIRHPGKSCMTILTMVKYEWFEEWKDTTVRKRGDEYY
NYKMRFAKNLFDWACTVFPKIKDKLVFQDVATPLSNAHYLGAQRGAMYSAEHNLDRFHAE
AVARNRCNTPIKNLYMSGQDVFSCGIAGALHGGLLCASAVLNHIVYIDLLFLKKKLKRRK
AQEMA
Download sequence
Identical sequences H2T011
31033.ENSTRUP00000017999 ENSTRUP00000017999 ENSTRUP00000017999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]