SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000018194 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000018194
Domain Number 1 Region: 185-379
Classification Level Classification E-value
Superfamily E set domains 5.13e-76
Family Cytoplasmic domain of inward rectifier potassium channel 0.000000535
Further Details:      
 
Domain Number 2 Region: 77-201
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.49e-24
Family Voltage-gated potassium channels 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000018194   Gene: ENSTRUG00000007361   Transcript: ENSTRUT00000018270
Sequence length 430
Comment pep:novel scaffold:FUGU4:scaffold_131:335192:338494:-1 gene:ENSTRUG00000007361 transcript:ENSTRUT00000018270 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RLPADTDVKVVDIRENDAEDRITCSAPLSPQVKKLPKHLREPQISTERTHLISDPVKKPR
QRYVQKDGKCNVHHGNVKETYRYLSDLFTTLVDLRWRFSLLIFTLVYVVNWLFFGFLWWL
IALIRGDLVHADEEGWTPCVENLNSFVSAFLFSIETETTIGYGYRVITEKCPEGIILLLV
QAILGSIVNAMMVGCMFVKISQPKNRAETLMFSHKAVISVRDNKMCLMFRVGDLRNSHIV
EASIRAKLIRSQQTKEGEFIPLNQTDINIGFDTGDDRLFLVSPLIISHEINEKSPFWEMS
LAQMEKEEFEIVVILEGMVEATGMTCQARSSYLDTEVLWGYRFTPVLSLEKGFYEVDYNN
FHDVYETNTPACSAKELAAKLREEPLLPQLSLLSPESKMQTLDEDKEEESGADRGETNGS
AAALEEQALA
Download sequence
Identical sequences H2T0K6
31033.ENSTRUP00000018194 ENSTRUP00000018194 ENSTRUP00000018194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]