SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000018397 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000018397
Domain Number 1 Region: 127-332
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.31e-53
Family DBL homology domain (DH-domain) 0.000000318
Further Details:      
 
Domain Number 2 Region: 318-486
Classification Level Classification E-value
Superfamily PH domain-like 7.38e-32
Family Pleckstrin-homology domain (PH domain) 0.0071
Further Details:      
 
Domain Number 3 Region: 597-711
Classification Level Classification E-value
Superfamily SH2 domain 2.02e-28
Family SH2 domain 0.00059
Further Details:      
 
Domain Number 4 Region: 749-819
Classification Level Classification E-value
Superfamily SH3-domain 1.97e-22
Family SH3-domain 0.00066
Further Details:      
 
Domain Number 5 Region: 1-69
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000000000000408
Family Calponin-homology domain, CH-domain 0.0036
Further Details:      
 
Domain Number 6 Region: 524-600
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000748
Family SH3-domain 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000018397   Gene: ENSTRUG00000007437   Transcript: ENSTRUT00000018473
Sequence length 822
Comment pep:novel scaffold:FUGU4:scaffold_249:286547:318239:1 gene:ENSTRUG00000007437 transcript:ENSTRUT00000018473 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TQFLCLKNIRTFLMACTEVFGMRKSELFESFDLFDVRDFGKVVDTLSKLSHTAIAQQTGI
RSFPSEESVEDEDIYNHLEDLIDEKVVEDEEDLYDCVYDEEDGGEIYEDLMKTEALPPPG
SQPFQKQAEIDIRSCCLTEIKQTEEKYTETLESIEKHFMSPLTSYLSAAEIESVFVNIPE
LVKVHKCLLVEVQDSLHHRSAQNLYQIFLNFKERLLIYGKYCSHVETAIGTLDELCKDRE
DIRMKLEECSKRANYGKFTLRDLLVVPMQRVLKYHLLLQELVKHTHDATDKGNLRLALDA
MKDLAQYVNEVKRDNETLREIDQYQKSIENLNQALSNYGRPKGDGEVRVASVDKRAKQDR
HIFLFDAAVIVCKRRGDNYEMKEVIDLHLFKITNNPTSDKETRKRNEQLRWWSYGFYLTH
KQGQSGFEFFFKTKELKKKWLEQFGMAISNILPENATNNFHDFHMHTFERITSCNSCHML
LRGVFNQGYLCSKCGLGAHKECLGRFSGCGKTDPGSVRSQGKGRDPGGLPKMLVIRSYFG
VPSPASGPALSIEMGDIIELLCADIHSPWWQGRILSTKEVGFFPSDAVKPCPCVSSFALP
PPRRQVPKPVDYSSQPWFAGPIERLQAEAELINRVNGTYLVRHRSREYTEYAISIKYNND
VKHIKILTKEGCFYIAENKKFRSILELIEYYKHHSLREGFRSLDTTLHFPYREQENAALQ
RLSRSGSNTIAPLLCGLSFVSPAGYSFVPPSSAPFWSVLTPKVIGVAIARYDFSSRDTRE
LSLQEGDVVKIYTKSGANGWWRGEVNGRVGWFPSTYVEEGEE
Download sequence
Identical sequences H2T159
31033.ENSTRUP00000018397 ENSTRUP00000018397 ENSTRUP00000018397

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]