SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000019057 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000019057
Domain Number 1 Region: 17-153
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.96e-39
Family Calponin-homology domain, CH-domain 0.00000472
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000019057   Gene: ENSTRUG00000007680   Transcript: ENSTRUT00000019135
Sequence length 222
Comment pep:novel scaffold:FUGU4:scaffold_95:279190:280305:-1 gene:ENSTRUG00000007680 transcript:ENSTRUT00000019135 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANRGPSYGLSREVQEKIEQKYDPDLEQRLVDWILVQCGGDLERPQPGKDDFQKWLMDGT
ILCRLINSLYPKGEEPIKKIPETQMAFKQMEKISQFLRAAEAYGVITTDIFQTVDLWEGK
DMATVQRTLMALGSLAVTKDDGHYRGDHEWFHRYISLNGMFAMLQLPLPHLCLLFRKAQG
YRREFSQEQLRQGRSLIGLQMGSNRGASQSGMTGYGMHRQIM
Download sequence
Identical sequences H2T319
ENSTRUP00000019057 ENSTRUP00000019057 31033.ENSTRUP00000019057

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]