SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000019101 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000019101
Domain Number 1 Region: 390-616
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.09e-37
Family Calponin-homology domain, CH-domain 0.00013
Further Details:      
 
Domain Number 2 Region: 88-242,386-470
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.91e-24
Family FAD/NAD-linked reductases, N-terminal and central domains 0.086
Further Details:      
 
Domain Number 3 Region: 711-743
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000317
Family LIM domain 0.015
Further Details:      
 
Domain Number 4 Region: 744-772
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000373
Family LIM domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000019101   Gene: ENSTRUG00000007695   Transcript: ENSTRUT00000019179
Sequence length 1164
Comment pep:novel scaffold:FUGU4:scaffold_85:882671:915453:-1 gene:ENSTRUG00000007695 transcript:ENSTRUT00000019179 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGATGRDGANHSHVLFDNFVQASTCKGTLKAFQELCDHLDVKPTESRIFYHKLKSKLNYW
KAKALWAKLDKRACQKEYKKGRACANSKCLIIGAGPCGLRTAIELALLGAKVVLLEKRDA
FSRNNVLHLWPFAIQDLRGLGAKKFYGKFCAGAIDHISIRQLQLMLLKMALLLGIEIHVN
VEFKGLVEPPEDQETEKIGWRAEVHPRTHPVNELEFDVIIGADGRRNTLPGFRRKEFRGK
LAIAITANFINRNTTAEAKVEEISGVAFIFNQKFFQDLREATGIDLENIVYYKDDTHYFV
MTAKKQSLLEKGVILHDYADTELLLSRANVDQAALLSYACEAADFSTNHQLPTLDFAINH
YGQPDVAMFDFTCMYASENAAMVRQRQGHNLLVALVGDSLLEPFWPMGTGIARGFLAAMD
SGWMVRSWAQGKTPLEVLAERESIYRLLPQTTPENVNKNFSQYSLDPITRYPNVSLHFLK
PSQLRHLYDTGESREIRMEIENVINSSTPKLASKLLSWCQRQTEGYRNVRVTDLTMSWKS
GLALCALIDRYRPDLIDFESLDEKDYEQNNQLAFDVAEREFGISPCMTGKEMSSVVEPDK
LSMVMYLSQFYEMFKDTVPPGDNHNLSPEEKAALIASTKSPISLLSKLGQSIAISRKRNP
KDKKEKDVDSLGKRRKTSQSEELAGGDSRGVCDDRSSVPAVLSEKKEFPTNIGGSDVCFF
CHKRVYVMERLSAEGKFFHRSCFKCEYCGTTLRLSSYAFDVEDGKFYCKPHYCYRVSGMM
PPSFSPVFNANQSQVLPLSNSSSESDMEDEQEEQDQEEEEEEAEQPPASPSDLGGVPWKE
AVELHAKLRGSHGAEGEAGADTVSGDGELEEEEDDEEEEEEDEEEEEEDSSEDAEAEEET
PSKKTDIIEEFWQKKHLVTWSNGAEKTPSELAKEPADRKLSPPPIKSPVSAPQRVSTPQA
DKEAAPVVVVMREKKKKPRPSEDSGKKKISPPGRSSDRNGLIGGGVNQVPLFLRAIRRQA
KQEELKRLHRAQIIQRQLEQVEEKQRQLEERGVAVEKALRGEAGMGKKDDPKLMQEWFKL
VQEKNALVRYESELMIFARELELEDRQSRLQQELRERMAVEDHLKTEKELAKEKQILNEM
LEVVEQRNDLVALLEEQRLQEKEE
Download sequence
Identical sequences H2T363
ENSTRUP00000019101 31033.ENSTRUP00000019101 ENSTRUP00000019101

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]