SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000019118 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000019118
Domain Number 1 Region: 44-173
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 7.07e-48
Family Calponin-homology domain, CH-domain 0.000000664
Further Details:      
 
Domain Number 2 Region: 245-305
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 3.66e-18
Family EB1 dimerisation domain-like 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000019118   Gene: ENSTRUG00000007698   Transcript: ENSTRUT00000019196
Sequence length 337
Comment pep:novel scaffold:FUGU4:scaffold_107:359711:363759:-1 gene:ENSTRUG00000007698 transcript:ENSTRUT00000019196 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGPTQALSPNGENNNDIVPESGSNIIPYRKNTVRQERAYSWGMAVNVYSTSITQETMSR
HDITAWVNDILCLNYTKVEQLSSGAAYCQFMDLLFPGCISLKKVKFQAKLEHEYFHNFKL
LQASFKRMNVDKIIPVEKLVKGRFQDNLDFIQWFKKFFDANYDGKEYDPVAARQGQDAIP
PPDPGEQIFNLPKKSHHAASSPTAGASRSAATTPKSSTPTSRPSSAKKIPIPSTPAKGEK
ELEAQVTQLTDQVNTLKSALEGVEKERDYYFSKLREVELLCQEQSEENAPFVDRLMEILY
ASDEQEGAELAEGNGEEAEQQIQEEGGDDQQEEQDEY
Download sequence
Identical sequences H2T380
XP_011614400.1.43653 ENSTRUP00000019118 31033.ENSTRUP00000019118 ENSTRUP00000019118

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]