SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000019316 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000019316
Domain Number 1 Region: 591-893
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.7e-55
Family G proteins 0.00000925
Further Details:      
 
Domain Number 2 Region: 937-1057
Classification Level Classification E-value
Superfamily Initiation factor IF2/eIF5b, domain 3 4.58e-32
Family Initiation factor IF2/eIF5b, domain 3 0.00033
Further Details:      
 
Domain Number 3 Region: 1061-1192
Classification Level Classification E-value
Superfamily Translation proteins 8.95e-31
Family Elongation factors 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000019316   Gene: ENSTRUG00000007772   Transcript: ENSTRUT00000019394
Sequence length 1193
Comment pep:novel scaffold:FUGU4:scaffold_57:532633:540255:1 gene:ENSTRUG00000007772 transcript:ENSTRUT00000019394 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKKQKKSGEDSAKDDGVDIDALAAEIEGAGASKEIKGKKKKKGAKKDDFDEDDILKELE
ELSLEARGGKGKVSAATKSTQFNHRFCSQARGQKMKHKVDTTEHTQSIQPPKPEKKKTRK
EKKGASSLDDEEGEEDHPAEERNGQQKGNKKVKSEKDDEDDEKSVKKGGDGEKDDDDDSE
DEFAFRRDKKKKKNKGKAAKAESEDEEEQDGEDGGGFKMKTAAQKKAEKKERDRKKKEEE
RLKQKKLKEANAEVKKEAEKKTVTAEATPTPPAAVMEEEDDKPEPAADDEADSDKKKKDK
KKKKVEKEEKEKKKGPSKATVKAMQEALAKMKEEEERVRREEEERQRRLEELERQRQEQE
RLEQERKEKKKQKDKERKERMKKEGKLLTKAQKEARARAEATLKMLQAQGVEVPSKDSMP
KKKPVYGDKRKRKPNVHTPEETSQVTSPTSKTPEPVAVVTEAKTPAAEPGLSAEVKPDAD
VDDWEAIATDEEKDLKKVHIEVKEETASPPQPAGSDEDEEEADDEDEEDDDDEEDVSEEE
AVKEVAPVSQGKRKPAKESEDESSESDDDDGRTKEQRLYDRAKRRIEKRKAENLKNIKLD
MLRAPVVCVLGHVDTGKTKILDKLRHTHVQDGEAGGITQQIGATNVPKETIVEQAKMVKN
FDKENLKIPGMLIIDTPGHESFSNLRNRGSSLCDIAILVVDIMHGLEPQTLESINLLKEK
KCPFIVALNKIDRLYDWKKSPDTDVVATLKKQKKNTKDEFDERAKAVIVEFAQQGLNAAL
FHENKDPRTFVSLVPTSAHSGDGMGNLIALLVELTQTMLARRLAHCDELRAQVMEVKALP
GMGTTIDVILINGRLREGDTIIVPGVEGPIVTQIRGLLLPPPLKELRVKNQYEKHKEVAT
SQGVKILGKDLEKTLAGLPLLVANKEDEVPVLRDELVRELKQTLSSIKLEEKGVYVQAST
LGSLEALLEFLRTSKVPYAGINIGPVHKKDVMKASTMLEHDLQYAVILAFDIKVEREAQE
MADTLGVQIFAADIIYHLFDSFTKYREEYKKAKQEEFKHIAVFPAKLRILPQFIFNSRDP
IVVGVCIDAGVLRQGTPLCVPSKGFVDIGVITSIELNHKTIDCAKKGQEVCVKIEPIPGE
SPKMYGRHFEATDMIVSKITRASIDALKNWFRDEMQKTDWQLIVELKKIFEII
Download sequence
Identical sequences H2T3S8
31033.ENSTRUP00000019316 ENSTRUP00000019316 ENSTRUP00000019316

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]