SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000019570 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000019570
Domain Number 1 Region: 48-235
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.42e-41
Family SPRY domain 0.0000203
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000019570
Domain Number - Region: 226-263
Classification Level Classification E-value
Superfamily SOCS box-like 0.000497
Family SOCS box-like 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000019570   Gene: ENSTRUG00000007869   Transcript: ENSTRUT00000019650
Sequence length 264
Comment pep:novel scaffold:FUGU4:scaffold_48:157654:158572:1 gene:ENSTRUG00000007869 transcript:ENSTRUT00000019650 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSVWLCNRVNSSPPTPSSEFPLLAVPVSSRLAITLKAPPVAPGDKCSRWSSVHHSPNFQL
SPCKQEVTRLPVEWSSDGVRAEKGVKTGLHIWEVIWNPNHRGSHAVLGISRQNCPLQASG
YNVLIGGDSESWGWELRTNQLWHAGERLRRYPERRTAQSPLPIPERILLVLDADAGTLGF
SVDGSFLGVAFKDLPGGVDLFPAVSSVRGGASIRLRYLNGARRDPPALMDLCALAIQQHL
GQQRHNQICNLPLPQPLRHYLLST
Download sequence
Identical sequences H2T4I2
31033.ENSTRUP00000019570 ENSTRUP00000019570 ENSTRUP00000019570

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]