SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000021866 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000021866
Domain Number 1 Region: 41-499
Classification Level Classification E-value
Superfamily Sema domain 9.16e-110
Family Sema domain 0.000093
Further Details:      
 
Domain Number 2 Region: 1317-1445,1646-1803
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.88e-42
Family p120GAP domain-like 0.01
Further Details:      
 
Domain Number 3 Region: 502-551
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000127
Family Plexin repeat 0.0021
Further Details:      
 
Domain Number 4 Region: 836-940
Classification Level Classification E-value
Superfamily E set domains 0.0000000000182
Family Other IPT/TIG domains 0.0072
Further Details:      
 
Domain Number 5 Region: 937-1002
Classification Level Classification E-value
Superfamily E set domains 0.0000000000904
Family Other IPT/TIG domains 0.073
Further Details:      
 
Domain Number 6 Region: 1030-1113
Classification Level Classification E-value
Superfamily E set domains 0.0000649
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.031
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000021866
Domain Number - Region: 1468-1562
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00626
Family Ubiquitin-related 0.031
Further Details:      
 
Domain Number - Region: 799-831
Classification Level Classification E-value
Superfamily Plexin repeat 0.0576
Family Plexin repeat 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000021866   Gene: ENSTRUG00000008707   Transcript: ENSTRUT00000021955
Sequence length 1860
Comment pep:novel scaffold:FUGU4:scaffold_21:244045:267933:-1 gene:ENSTRUG00000008707 transcript:ENSTRUT00000021955 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FSKPVLSELVLVDMMKWWWWGTWQLVALTTTCLGSTEGKTSEFLSDTLINNVVADPRTGF
LYVGAVNSLYQLSPDLEVQSRDETGPKRDSRLCTPPITEACEEAVDTDNHNKLLLVHPAE
NTLVVCGSIFRGICSLRNLSSVEDLLYYSDTKGEKSYVASTEESVSVVGVMSQYGKVGDS
LPVFLVGKGYGSYDSAKLISTRILEDYGDWVVFDSIIEAAGVQSNPFVLRYLHDFRFAFK
DGHHVYFLFSRTLGIQDTKNYTFISRMCENDLGYFSYTELQLNCSTTNKYNKAQAAFVAT
PGVLLAQNLTSTGQYEQVSPSDKVLFVTFTSDEDPSSSAMCMYPLRFINEKLVKIIEACY
SGKGVIDGKPSVYLPYLSNPDECRSSNKKNMAVNYSCGAEFLPSPLASKAGFALKAEPLL
ERKGQLTAVAVAVEMEHTVAFVGSATGEVLKVHLSAHPEVYGRASAEVTGDKVNKNLLFD
SSLQHLYITREKRITKVPVQTCHLKTDCQSCMSLKDPYCGWCVLEGKCTRKQECSRSSGS
NAWLWSPDQKCVEIQSFNPPNLSCKKKDQVDIIIPKHPELGSSDKLYCVFENLTTEALFD
GKTLVTCSLPDPVEIPPTPDQQDYVSVPVKILVNKNIEVTSGEYHFYNCAATVCVCVCVC
VCVCVCVCVSTHVPSIPKADVCVFTLKSNRCPQFESPEPLLIPVGFEIPISFQGRNLDIY
KSSSSFIHRLWLIHRNIVPLQGRKFTIGTELMKNIEREVTQEQGSKFTFSGYKVSIGHHI
INSFPCFGVGLYNCSVGREDCSLCRHADATYQCVWCTATHMCVYQELCRLSAPAQCPKPE
ITDIIPRFGPLNGRISVTIKGSNMGIKKEDIKKITVAGVDCAHQEDRYSVSTSVVCEIGP
AKRVPPSDLPFEPTHAGVVEVEVEGGRHGRSQVIFTYRDPKPVAVHPAKGPAAGGTVITI
TGEDLDTATKEDVTVTVGGVSCEVLSFGVLITCKTGKYRGQKLPSDLMTVTVKYGENTTK
DILSAYQYSENPKVTDYNPKASFLCGGRKIVVTGNGFDLIQRATIKFVEEARSKNDTVLQ
FDSPAVNSSCKALRTFLQLDNVVEKLKSFDYHPDPSXNELLNPEDKLILEAPSPQPKSRS
KRPRRDTTNEMLELVVKKKTLCQRCVLAQKALCLQLEHTVNNTHFHPPPGEVWSRKDDIP
LAIIIPAVIIPMIIFIAVSVYCYRRKSQQAEREYEKVKHQLENLEESVRDRCKKEFTDLM
IEMEDHTNDLSEARMPFLDYKTYTDCNFFLPSKDGANDAMITRKLQIPEARRAIVAQALN
QFSNLLNSKTFLINFIHTLESRPDFNARARGYFASLLTVALHGKLEYYTDIMRTLLLELM
DEHVQNKNPKLMLRRSETVVDRMLYNWMSICLYQFLRDTAGEPLYKLFKALKHQVEKGPV
DAKMKKAKYTLNDTGLLGDDVEYSVLTLQVLVHGEGPDVTPVKVLSCDTITQVKEKIIDQ
VYRNLPYSQRPKVESVALEWRPGSTGQILSDLDLTAQKEGRWKKLNTLAHYNVRDNATLV
LSRVLHTQSFYQHQDSYEESTQHTHTLTHSYFSHTSSLSLCVMLTENSLLEEDNTFHLVR
PADDIDEVKSKRGSMKDKAMTKAITEIYLTRLLSVKGTLQQFVDDFFRSVLCSNSIVPPA
VKYFFDFLDEQALKHDNVDEETLHIWKTNSLPLRFWVNILRNPHFIFDVHVTEVVEASLY
VISQTLMDACTKTEHKLSRESPSNKLLYAKEISSYKKMVDDYCKGIRQMVPVSDQDMNTH
LAELSRQHTDKLNTQVALHQLYQYASKYYDVIIQSLDEDPAAQNKQLTLRLQQIAAALEN
Download sequence
Identical sequences H2TB26
ENSTRUP00000021866 31033.ENSTRUP00000021866 ENSTRUP00000021866

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]