SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000022599 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000022599
Domain Number 1 Region: 1168-1271
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.4e-28
Family Calponin-homology domain, CH-domain 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000022599   Gene: ENSTRUG00000008985   Transcript: ENSTRUT00000022693
Sequence length 1625
Comment pep:novel scaffold:FUGU4:scaffold_219:203838:221772:1 gene:ENSTRUG00000008985 transcript:ENSTRUT00000022693 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSVWKRLQRVGKKASKFQFVASYQELTLECSKKWQPDKLRVVWTRRNRRMSSKLHSWQP
GIKNPYRGMVVWPVPENIDISVTLFKEANADEFEDKEWTFVIEGENKGHRKVLASADINL
KRFASPTPTQIDLTLTLKPLSVKVVEATLKLSLSCVFIREGKATDEDMQSLASLMSVKPA
DIGNLDDFNESDEDENKNPSSPQPSPRSKHNPLTNQLLLSNPFNSAAPPVTAPENQSAFP
EVSPSPKSLLVTPIQESSSSLHHPTLPECGTILPLASTRPSPASGSSANILSSPLLSSPL
PQIVKSAGHPCSPSPPASGPPLPKPQPCVSESVLLPPAGKGSPWSHGEDMQQSNLADVRE
SKQPVCPAQDSKMSITQCRAQKPNEKASGEGEQIKRAAEENDGVEKAEQERQKERLTNQE
KEKRKKVEEKKIQEQEDRRKHEKEKKRLLEEEKKRLLWEEEEFRKDRERRKQEEDRLLQE
KREKQKRLREDEEKRKKEEEKDKREKEQEKKTLDAGEKEKLMKEEERRLERERLLKKMTE
EDKKRAEKMRVMEEQRRWMEEQLFKEPKQQEQKIKVEEQNTREVEGRKKKKAEDERRNQE
EGKGVKEAEERKKKEAVEKERQQREMDSVKKEERKKEERVKEKELEEEKKKEETEGMNQG
KRSVLKQVSVSNIVVPEKNISDTDTPPDIHSGYVALEVVMVTPPPQRLSDAEVPIWKVLE
LMQITAISDPSSHEKNSPSEIPPSAVGKMKKMREATQKHDELSLVARLRLAASEREKERE
GKEKEKIENTARQREVKEPQTGEKREITEEQDNRGEQREKTKGEGVRLEKRMEGKKKDED
KEQENEEEKREIRRKEKENREERMRLDIEKENIRREKEEERKRLEVERKEMERKERERVT
EKIQLQKEREELEKEREEERKRLEHQKEELERKERERGGEKRKLEKEREKLEKEIEEKRK
RLEHQKEELKRKESEREDEKRKLEKEREELKKEREEEIKRLEKRKEELERKERKWEEERR
RLEGERNEIKRKENEKQTEMLKLQKEREKLEKEREEGRKRLEKRKEELERKEREREEEKR
KKLKRDREMMEKERQDERKKLQKERQELEKEIEKERRRMEKEKEELMRTEMAKEEERNIL
RKETEKRKKEKEEERKMLEKESPQDLVISSQSLLEWCQGITDSYPGVKVTNFSTSWRNGL
AFCAILHHFHPEKIDFETLEAHDIKLNNKKAFDGFEALGISRLLEPSDLVLLSVPDRLIV
MTYISQIRSHFTDQELSVLQIERNSSQSSYGHPRCGPCPSDEDAAAFCMARLNEGVSLEE
GGSSTLVIPPPRTKRPVKVPCPPSGDDLITTPPRGVNKLAKPGPQVPSSPFPLPTAYFLL
HRMKVRRRAQLQRSPIMQVRPEYFVMKCCRVTNVVFVRRAAEQNCNTRRNTGSPPSPLSD
LSPSFIFPLYHFFPTYARLHCLQDTSQYVLSELAALELEQKHVDSRAAVVERRLRSLMET
GNDRDEEERLIQEWFTLVNKKNALIRRQDTLELLQEEQDLERRFELLNRELRVMMAIEDW
QKSSTQQQREQLLLQELVSLVNQRDEIIRDIDAKERGALEEDAHLERGLEMRRQKYSNKE
KCVLQ
Download sequence
Identical sequences H2TD57
31033.ENSTRUP00000022599 ENSTRUP00000022599 ENSTRUP00000022599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]