SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000022658 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000022658
Domain Number 1 Region: 2-105
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.44e-27
Family Calponin-homology domain, CH-domain 0.0000649
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000022658
Domain Number - Region: 160-190
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000699
Family LIM domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000022658   Gene: ENSTRUG00000009009   Transcript: ENSTRUT00000022752
Sequence length 821
Comment pep:known scaffold:FUGU4:scaffold_253:304860:309854:-1 gene:ENSTRUG00000009009 transcript:ENSTRUT00000022752 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSLTALRDWCRDACAGYPDVEIKNMSASFRDGLAFCAIIHKHRPDLIDFSALSKDNSYQ
NNQLAFETAEKLGIPALLHPKELACSEVPDSLGVITYLFWYFCFFHETSSAGLASLGTSH
VTDAKQLPRTKTPDGPKQDEDSSRRESHRGLIGPRSSKVRVPAVCRLCLKPIHLIQRRLA
GGKIYHRSCLRCGVCHCTLLPHWCTQRGDSLVCSHHPAGVQGTEPELSGSAENRVRGSSK
VVRFLGESAVSSATGYTEGTQSGDKLASEAADREEKGGEETGAEGADSTASGQRLAEPSD
PPAPAVAHVAVEEAESCGAASSPLDATVQQEVTQQLPELSTKQEQPTAPWLQLFMSIFKS
ALFSLPSSTDPSEIFAFLVIFLRKFSKPVYLFSPAAAKDASSPHSTKHEKMNFHVSAPPS
SSNSGVRLRLNHPWLTIIHPGPWMQLPAAPPPVPSLRPRHRPRVSAPNPFERVDEEAKPQ
KAAANQSGRGASGGGVSNPAVPVTEKPHGGSDETVAGDALEGGNRGDGCTGAADARARVT
LSQQPKLPRSLSVPALTCSVPPPEGPEVGKTRPTEYAALINDNKDVTKLLCREAHCNQKA
ALTKSQTFHTPPSEQAPAPGHGFPLIKRKVQTDQNICPGSLQVEVTDLDKRLEAMERRGV
ELERNLRHCVSEEEEEEMLMEWFDLNHERHVLVRRDMELGYLMMQHKLEERQADVEYELR
RLLIKQENEWTEEERAEERHLMEELVSLIEQRNQIICSLDQDVQREREEDKLLKATLNSK
QLQKEGIKELRKSKGKLNPGKVFNLLHRRRSVGAKHPPDQR
Download sequence
Identical sequences H2TDB6
31033.ENSTRUP00000022658 ENSTRUP00000022658 ENSTRUP00000022658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]