SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000022727 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000022727
Domain Number 1 Region: 32-61,180-350
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.76e-62
Family G proteins 0.0000000369
Further Details:      
 
Domain Number 2 Region: 61-182
Classification Level Classification E-value
Superfamily Transducin (alpha subunit), insertion domain 4.06e-43
Family Transducin (alpha subunit), insertion domain 0.00000285
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000022727   Gene: ENSTRUG00000009040   Transcript: ENSTRUT00000022822
Sequence length 355
Comment pep:novel scaffold:FUGU4:scaffold_56:427151:442439:1 gene:ENSTRUG00000009040 transcript:ENSTRUT00000022822 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCTVSAEDKAAAERSKMIDKNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEDG
YSEDECKQYRAVVYSNTIQSMMAIVKAMASLKIDYSNPSRVDDAQQLFALSTAAEEQGSL
PEDLANVIRRLWGDSGIQSCFARSREYQLNDSAAYYLNDLERIAKADYIPTQQDVLRTRV
KTTGIVETHFTFKELHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSAYDLVLAEDEE
MNRMHESMKLFDSICNNKWFTETSIILFLNKKDLFEEKITRSPLAICFPEYTGANKFDEA
ASYIQTKFEDLNKKKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF
Download sequence
Identical sequences H2TDI5
ENSTRUP00000022727 31033.ENSTRUP00000022727 ENSTRUP00000022727 XP_003973372.1.43653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]