SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000022972 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000022972
Domain Number 1 Region: 122-295,384-494
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.81e-47
Family FAD-linked reductases, N-terminal domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000022972   Gene: ENSTRUG00000009132   Transcript: ENSTRUT00000023068
Sequence length 571
Comment pep:novel scaffold:FUGU4:scaffold_58:368070:371263:-1 gene:ENSTRUG00000009132 transcript:ENSTRUT00000023068 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWTFLGIVSFTYLYKKFDTFLTSAPRELVLAAVLCLAAGLLLSYTRRPPNVSARQREQIA
QPKLPHVLDYLFVLYFFSPSSYKSEGHDCLIFQSQRRRQETDLKSSSPQRASAGCPAEAP
EPDVVIVGAGVLGSAMAAVLARDGRRVTLVERDMKEPDRIVGELLQPGGYRALGKLGLKG
SVEGLDAHVVNGYVIHDRESGAEVEIPYPEVGQSIQCGRAFHHGRFIMGLRRAALAEPNV
TILEGTVTSLLEEDACVTGLQYRDKESGDVKEIRAALTVVADGCFSKFRKNLVPGKARTS
SHFVGCLMKDCPQFKANHAELVLADPSPVLIYQISSSQTRVLVDIRGEMPHNLSEYMAEK
IYPQLPEHLKEPFMVALQNDRLRSMPASFLPPSPVNKSGVLLLGDAYNMRHPLTGGGMSV
ALNDVCIWRDLLKNLPDLYDDSALLQAKKKFHWERKSSHSFVVNVLAQALYELFAATDSS
LHELRKACFQYFKLGGECVSGPIKLLSVLDPKPLTLIGHFFAVALYAIYFSFKSESWRTK
PRALFKSGAILYRACTVMFPLIYSELKYLVY
Download sequence
Identical sequences H2TE80
ENSTRUP00000022972 ENSTRUP00000022972 31033.ENSTRUP00000022972

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]