SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000023374 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000023374
Domain Number 1 Region: 1-130
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.15e-50
Family Calponin-homology domain, CH-domain 0.000000403
Further Details:      
 
Domain Number 2 Region: 218-280
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 4.58e-23
Family EB1 dimerisation domain-like 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000023374   Gene: ENSTRUG00000009296   Transcript: ENSTRUT00000023471
Sequence length 290
Comment pep:novel scaffold:FUGU4:scaffold_227:156463:158594:-1 gene:ENSTRUG00000009296 transcript:ENSTRUT00000023471 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVNVYATSVSVDNLSRHDMLAWVNDSLHLTYTKIEQLCSGAAYCQFMDMLFPGCILLKK
VKFQAKLEHEYIHNFKVLQAAFKRMNVDKIIPVEKLVKGKFQDNFEFVQWFKKFFDANYD
GKEYDPLLARQGQDVAPPPNPGDHFIHKPKRFSGKEITNSFSVMLLLKPDYINPGVPGPQ
RTSPTVPKNMPTPQRVQHNTPALRKNPSLSRNGGSDAEIMELNQQLMELKLTVDGLEKER
DFYFGKLRDIELICQEPESENHPILSKIMDILYATEEGFAPPEEDDLEEQ
Download sequence
Identical sequences H2TFC8
ENSTRUP00000023374 31033.ENSTRUP00000023374 ENSTRUP00000023374

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]