SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000023813 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000023813
Domain Number 1 Region: 11-220
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.07e-52
Family Ankyrin repeat 0.0000607
Further Details:      
 
Domain Number 2 Region: 234-273
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000017
Family SOCS box-like 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000023813   Gene: ENSTRUG00000009477   Transcript: ENSTRUT00000023911
Sequence length 274
Comment pep:novel scaffold:FUGU4:scaffold_103:554430:558586:-1 gene:ENSTRUG00000009477 transcript:ENSTRUT00000023911 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QDAVLFSNSLMSDVESDWSPLHDAAFNGRVLALQGLIGQGTCVNLSTLDRVSPLHGACAR
GHLACADLLIQNGANVNGSTVDGVTPLSEACARGHGTMASLLLQRGANPSGSDHTNSPIH
RAAAKGHPECMDPLVRHGADVDQVIEQQGSPLHVACSNQHLSTVRKLLELGACVNSSVRG
ESPLHIAARLSSPELASVLLDHGAAPSPRNWEGKRPLDLAPPDSPVERLLRQGGISPLMQ
LCRLHIRRTLGKWRLRGIDELHLPADIKRYLLYQ
Download sequence
Identical sequences H2TGL5
ENSTRUP00000023813 31033.ENSTRUP00000023813 ENSTRUP00000023813

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]