SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000024074 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000024074
Domain Number 1 Region: 5-106
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.28e-32
Family Calponin-homology domain, CH-domain 0.0000887
Further Details:      
 
Domain Number 2 Region: 189-218
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000254
Family LIM domain 0.023
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000024074
Domain Number - Region: 219-249
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000356
Family LIM domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000024074   Gene: ENSTRUG00000009581   Transcript: ENSTRUT00000024173
Sequence length 934
Comment pep:novel scaffold:FUGU4:scaffold_62:324696:332921:-1 gene:ENSTRUG00000009581 transcript:ENSTRUT00000024173 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSLKALQEWCRIQCEDYNDVHIKDMSRSFRDGLAFCAIIHRFRPELIDFASLSKENVYE
NNHLAFDVAETQLGIPALLDPEDMVSMKVPDRLSIITYVSQYYNFFNNKSHGTSTLCSFT
HHQMEEIVTAVSLSTANPPSMKRINSATLNEPAQKRTPTPFEDEVAASEPSEPVETPGDV
GPSAKRSSLSSTCAACHKHVHLVQRFLADGKLYHRSCFRCTECHSTLLPGSYKLESSSGV
LVCTHHVTKHTSANHNGRPDLSKGPPAAQSARTGRSTVPRASLSDRETEVVPSDGQPDNV
KPANDSVSVPVVSPNEAEPAEKDSEGNGEKEETPRSTSPPNPFDESDEGEQEEDNSTANC
LPSTPVDQQQGMARPVPAPRRASEPTPPPRPAPRVRLLRPADGENQKPPTPPKPRERSQS
PGSSMSSLSSGTHKPKDPPWLALVQSEHKKKKAPAPPPAGQAAVPNTGSPPSLKGGGSRP
STPPSPANPFDGDEDEGEESSTVEEERGEGASIPATAVAGHPWYSITQAAEATGADAPPS
AGSSSRSASPGGAKSKKRPAPRAPQPPAGTQNHPTTGITSVTCINCVFVPVCFTLPTALD
SASFLLFIFNPILPPVLPHSESSSCSPSPALSTDSLSSSSDHSSSQLLQCGRASGDQLPV
FTKSVSEPSICSPSDPTSSSEHLPRTPLYPPPMSSNATSAPATPQTGRSSGAAAPSVTPS
PLASGGTQSHIKGTLNKSHFWISGPARRTRSTERPPPPLPNPIKDHQKALVLPDPQLLAM
ASLSSSADQYIPAEDIYGEMKQLEQLLDELEQRGVELEKKLRDNPNDEDEEHLLVDWFTL
IHEKHLLVRREAELVYTAKQQNLEERQADVEYELRCLLNKPEKDWTEEDKSREQELMAEL
VTIIEQRNQIVNNMDQDRQREEEEDKLIGAMLKK
Download sequence
Identical sequences H2THC4
ENSTRUP00000024074 31033.ENSTRUP00000024074 ENSTRUP00000024074

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]