SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000024584 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000024584
Domain Number 1 Region: 4-187
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.14e-47
Family Calponin-homology domain, CH-domain 0.0000604
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000024584   Gene: ENSTRUG00000009783   Transcript: ENSTRUT00000024683
Sequence length 315
Comment pep:novel scaffold:FUGU4:scaffold_212:394331:398879:-1 gene:ENSTRUG00000009783 transcript:ENSTRUT00000024683 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMAFNKGPAYGLSAEVKNKIAQKYDLQKEEELRLWIQDVTGHPIGADFQKEMKSGVVLCE
LINHLAPGSVTKINTKSTLNWHQLENLANFIKAITAYGLKPHDIFEANDLFESGNMTQVQ
TTLLALASMAKTKGCQTQVDIGVKYADKQERSFDEEKMKAGQCVIGLQMGTNKCASQAGM
SAYGTRRHLYDPKAQIQPPMDSTTISLQMGTNKGASQAGMTAPGTRRAIYDTKLCTDKCD
NTTMSLQMGYSQGANQSGQNFGLGRQIYDSKYCTAASPVPEEPGRPGNYIHDYQDEGYQG
YQEEEQVYHDDGTDY
Download sequence
Identical sequences H2TIT2
31033.ENSTRUP00000024584 ENSTRUP00000024584 ENSTRUP00000024584

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]