SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000024799 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000024799
Domain Number 1 Region: 19-249
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.5e-87
Family Calponin-homology domain, CH-domain 0.0000135
Further Details:      
 
Domain Number 2 Region: 267-389
Classification Level Classification E-value
Superfamily Spectrin repeat 2.59e-32
Family Spectrin repeat 0.0000011
Further Details:      
 
Domain Number 3 Region: 503-622
Classification Level Classification E-value
Superfamily Spectrin repeat 2.62e-27
Family Spectrin repeat 0.00000695
Further Details:      
 
Domain Number 4 Region: 390-499
Classification Level Classification E-value
Superfamily Spectrin repeat 6.81e-25
Family Spectrin repeat 0.00000506
Further Details:      
 
Domain Number 5 Region: 627-739
Classification Level Classification E-value
Superfamily Spectrin repeat 1.31e-20
Family Spectrin repeat 0.00000907
Further Details:      
 
Domain Number 6 Region: 732-781,809-886
Classification Level Classification E-value
Superfamily EF-hand 9.94e-20
Family EF-hand modules in multidomain proteins 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000024799   Gene: ENSTRUG00000009876   Transcript: ENSTRUT00000024900
Sequence length 914
Comment pep:novel scaffold:FUGU4:scaffold_181:255443:283875:1 gene:ENSTRUG00000009876 transcript:ENSTRUT00000024900 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NNQASGGGPQTYMEQENDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFR
DGLKLMLLLEVISGERLPKPERGKMRVHKINNVNKALDFIASKGVKLVSIGAEEIVDGNA
KMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNVQNFHISWKDGLAFN
ALIHRHRPDLIDYDSLRKDDPVTNLNNAFEVAEKHLDIPKMLDAEDIVNTARPDEKAIMT
YVSSFYHAFSGAQKAETAANRICKVLAVNQENEQMMEDYEKLASDLLEWIRRTIPWLQNR
TQEKTVNDMQAKQEDFRDYRCVHKPPKVQEKCQLEISFNTLQTKLRLSNRPAFMPSEGRM
VSNINGAWHTLEGAEKGYEEWILSEIRRLERLEHLAEKFHQKAAIHEAWTDGKEAMLTQK
EPDTTTLSEIKALLRKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSANVNARCQKIC
DQWNVLGALTQSRKESLKNKEKQLESIDELYLEYAKRAAPFNNWMESAMEDLQDMFIVHN
IEEIQGLIAAHEQFKATLTEANEERKAIQAIQANVPKIAQSNNITLTGSNPYTTITSENI
DEKWAKVFELVPRRDTALQDELNKQNSNDELRAKFASQANKVGAYIKAKMEEIGRISIEM
NGTLEDQLTNLKDYQDSIVSYTPEINTLEGYHQLIQEALVFDNKYTPYTMEHLRVSWEQL
LTTIARTINEVENQILTRDAKGISQEQLYEYRTSFNHFDKDHSGALMAEEFKACLISLGY
DVENDKQKRTGQMVSDDFRALLISTGNSLGDAEFGRIMSIVDPNGTGAVTFQAFIDFMSR
ETTDTDTADQVIASFKILAGDKNFITAEELRRELPPDQAEYCIARMAPYTGPDAVAGALD
YMSFSTALYGESDL
Download sequence
Identical sequences H2TJE5
31033.ENSTRUP00000024799 ENSTRUP00000024799 ENSTRUP00000024799

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]