SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000025142 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000025142
Domain Number 1 Region: 4-187
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.31e-45
Family Calponin-homology domain, CH-domain 0.0000049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000025142   Gene: ENSTRUG00000009995   Transcript: ENSTRUT00000025245
Sequence length 298
Comment pep:novel scaffold:FUGU4:scaffold_151:551904:563642:1 gene:ENSTRUG00000009995 transcript:ENSTRUT00000025245 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTHFRSGPAFGLSAEVKSKLAAKYDSQKEEELRLWIEDVTSKRIGDNFMDSLKDGVILC
ELINVLQPGSIKKINNPSQNWHQLENIGNFVRAITDYGLKPHDLFEANDLFENMNHTQVQ
STLIALAGMAKSKGFHSNYDIGVKYAEKQQRHFPPEKLREGRNIIGLQMGTNKLASQKGM
TSYGTRRHLYDAKMAMDNPMDQSTISLQMGTNKGASQAGMTAPGTRRHIFDRKLELENCD
STTISLQMGTNKVASQQGMTTYGLPRQVYDNKYCTNPNEAYYDNGSEVEFDSYNQYSD
Download sequence
Identical sequences H2TKD8
ENSTRUP00000025142 XP_003966442.1.43653 XP_011604310.1.43653 ENSTRUP00000025142 31033.ENSTRUP00000025142

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]