SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000025251 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000025251
Domain Number 1 Region: 45-799
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.58e-276
Family Motor proteins 0.000000000145
Further Details:      
 
Domain Number 2 Region: 2093-2183
Classification Level Classification E-value
Superfamily PH domain-like 3.57e-21
Family Third domain of FERM 0.016
Further Details:      
 
Domain Number 3 Region: 1254-1357
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.33e-20
Family First domain of FERM 0.032
Further Details:      
 
Domain Number 4 Region: 1978-2092
Classification Level Classification E-value
Superfamily Second domain of FERM 2.88e-19
Family Second domain of FERM 0.0028
Further Details:      
 
Domain Number 5 Region: 1349-1444
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000000000000102
Family Second domain of FERM 0.0087
Further Details:      
 
Domain Number 6 Region: 1878-1986
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000000145
Family Ras-binding domain, RBD 0.09
Further Details:      
 
Domain Number 7 Region: 1603-1655
Classification Level Classification E-value
Superfamily SH3-domain 0.00000159
Family SH3-domain 0.0042
Further Details:      
 
Domain Number 8 Region: 795-865
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000835
Family Motor proteins 0.032
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000025251
Domain Number - Region: 829-952
Classification Level Classification E-value
Superfamily Lipase chaperone-like 0.0183
Family Lipase chaperone LifO-like 0.034
Further Details:      
 
Domain Number - Region: 1-55,99-106
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0784
Family alpha-D-mannose-specific plant lectins 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000025251   Gene: ENSTRUG00000010038   Transcript: ENSTRUT00000025354
Sequence length 2197
Comment pep:novel scaffold:FUGU4:scaffold_82:839017:855863:-1 gene:ENSTRUG00000010038 transcript:ENSTRUT00000025354 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVIVQQGDYVWLDLKTGREFDVPVGAVVKLCDSGQIQVADDEGREHWISPQSATNIKPMH
PTSIHGVEDMIRLGDLNEAGILRNLLIRYNEHIIYTYTGSILVAVNPYQLLPIYTPDQIR
LYTNRKIGEMPPHIFAIADNCYFNMQRNNKDQCCIISGESGAGKTESTKLILQFLAAISG
QHSWIEQQVLEATPILEAFGNAKTIRNDNSSRFGKYIDIHFNKRGAIEGARIEQYLLEKS
RVCRQALDERNYHIFYCMLRGMSPEMKVKLGLGLAKDYSYLTLGNCTACDGRDDLRDYSS
IQSAMKVLMFTETENWEISKLLAAILHMGNLRFEARTYDNLDACMVVRSPDLVTAAALME
VEPKDVMSCLTTRTLITRGESVVTPLSVGQGLDVRDAFVKGIYGRLFVWIVDKINAAIFR
PPSSENNIIRRSIGLLDIFGFENFIVNSFEQLCINFANENLQQFFVRHVFKLEQEEYNLE
DINWQHIEFTDNQEALDMIAIKPMNIISLIDEESKFPKGSDATMLYKLNSQHKFNSNYIP
PKNNYETQFGIQHFAGVVYYETRGFLEKNRDSLHTDIIQLVHSSKNKFIKQIFQADVAMG
AETRKRSPTLSSQFKRSLEMLMRTLSVCQPFFVRCVKPNELKKPMLFDRELCIRQLRYSG
MMETIRIRRAGYPIRYTFVEFVERYRVLMPGIKPAHIQEDLRGTCQQIVLARLGKHDDWQ
IGKTKIFLKDHHDMQLEIERDQAITDKVILIQKTIRGHKQRTNFLRLRSSVIVIQKFWRG
YRCRKNFRTMKSGFLRLQALFRSRKFFISYQTTRLRVTLIQARCRGFLVRQRFWRHLRAV
LTLQAYTRGMIARRLCHRLRAERHHRQEAERQRLAEEERLLNQMTAQRAKAEADRKHQER
LVQLVQQQEDREREEREESRRKKELLEQMEREKEQPVDHSDMVDQVFGFLGHTGPLPNRD
GQAPAGFEDLEKTPRWEECEEEVLNEAPPLPNDEHEDLSDYKFSKFAATYFQGVSTHTYI
RRPLKQPLLFHEDEGDQLAALAVWITILRFMGDLPEPKCQMMINDGSEKIPVMTKIYETL
GKRTYKRELQELQVEGENSSTENQKRNSVRHKLVSLTLKRKTKIAEEVTRRLTEVDHRME
GNSMLEDRPTSNLEKLHFIIGNGILRPTLRDEIYCQICKQLTQNPSKSSHARGWILLSLC
VGCFAPSEKFVKYLRTFLNNGPPGYAPYCEERLRRTFVNRTRTQPPSWLELQATKSKKPI
MLPVTFMDGTTKTLLADSATTASELCNALADKINLRDRFGFSLYIALFDKVSSLGSGSDH
VMDAVSQCEQYAKEQGAQERNAPWRLFFRKEIFTPWHDPADDDVATNLIYQQIVRGVKFG
EYRCEREEDLAELASQQYYVDYGSEIFLDRLLGLIPTYIPDREISSTKTAEKWMQLIVST
HKKGVHTKRRLNPHKVKEDVVDFARLKWPLLFSRFYEAFKFSGPSLPKNDVIVAVNWTGV
YFVDEQEQVLLELSFPEITAVSSSRCNIRLFFSLISFVRGGKLQGQSFTLATIKGDEYTF
TSNNAEDIRDLVVTFLDGLRKRSKYVVGLLDCPNPDLTAGVDSNFLSFSKGDLMILDEHD
GEHVMNSGWAHGVNDRTKHKGDFPADCVYILPTITRPQYELVALVTMTPDQRRESMGVST
SDLSDEEEKLKAYTLEEFSYDHFRPPPKNTLSRVMISKSRGKERLWSCTREPIKQPLLKK
VLAHEELTQEACVAFTPAVPVMKYMGDYPSKRVRSINELTDQIFEGALKAEPLKDEIFCQ
ILKQLTDNNIKYSEERGWELLWLCTGLFPPSNVLLPHVQKFLQAKKHYPLAADCMQRLQK
GLRNGSRKYPPHLVEVEAIQHKTTQIFHKVYFPDDSDEVFEVESSTKAKDFCHNISGRLL
IRSSEGFSLFVKITDKVISVPDGDFFFDFVRHLTDWIKKARHVKEGVGPSLTYQVFFMKK
LWTNTVPGKDSMADSIFHYYQELPKYLRGYHKCPREEVNQLAALIYRVKFEDDKSHFQNI
SKVLKDLIPQDQIRNLSPDDWKRSIIAYNKHSKSREEAKLSFLKIIYKWPTFGSAFFEVK
QTTDPNYPETLLIAINKHGVSLIDPKSKDILTTHPFTKISNWSSGNTYFHITIGNLVRGS
KLLCETSLGYKMDDLLTSYISQMLTTMTKQRSSRGNS
Download sequence
Identical sequences H2TKP6
31033.ENSTRUP00000025251 ENSTRUP00000025251 ENSTRUP00000025251

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]