SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000025527 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000025527
Domain Number 1 Region: 2232-2499
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.91e-70
Family Protein kinases, catalytic subunit 0.00000194
Further Details:      
 
Domain Number 2 Region: 1383-1584
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.36e-52
Family DBL homology domain (DH-domain) 0.0000108
Further Details:      
 
Domain Number 3 Region: 719-897
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.22e-50
Family DBL homology domain (DH-domain) 0.0000000122
Further Details:      
 
Domain Number 4 Region: 1582-1703
Classification Level Classification E-value
Superfamily PH domain-like 3.89e-36
Family Pleckstrin-homology domain (PH domain) 0.00073
Further Details:      
 
Domain Number 5 Region: 904-1023
Classification Level Classification E-value
Superfamily PH domain-like 2.41e-32
Family Pleckstrin-homology domain (PH domain) 0.000001
Further Details:      
 
Domain Number 6 Region: 2124-2218
Classification Level Classification E-value
Superfamily Immunoglobulin 6.15e-21
Family I set domains 0.014
Further Details:      
 
Domain Number 7 Region: 531-670
Classification Level Classification E-value
Superfamily Spectrin repeat 8.77e-21
Family Spectrin repeat 0.0059
Further Details:      
 
Domain Number 8 Region: 283-436
Classification Level Classification E-value
Superfamily Spectrin repeat 9.5e-20
Family Spectrin repeat 0.0018
Further Details:      
 
Domain Number 9 Region: 8-105
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000157
Family Spectrin repeat 0.0054
Further Details:      
 
Domain Number 10 Region: 1991-2057
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000249
Family SH3-domain 0.00014
Further Details:      
 
Domain Number 11 Region: 1068-1161
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000152
Family SH3-domain 0.0024
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000025527
Domain Number - Region: 115-210
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000288
Family Spectrin repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000025527   Gene: ENSTRUG00000010141   Transcript: ENSTRUT00000025631
Sequence length 2538
Comment pep:novel scaffold:FUGU4:scaffold_153:688993:717611:-1 gene:ENSTRUG00000010141 transcript:ENSTRUT00000025631 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VCVCVCVCAKVLDWIENHGEAFLSKHTGVGKSLHRARALQKRHEDFEEVAQNTYTNADKL
LEAAEQLAQTGECDPEEIYQAAHQLEDRIQDFVRRVEQRKVLLDMSVAFHTHVKEELQKE
LLDDVYAESVEAVQDLIKRFGQQQQTTLQATVNVIKEGEDLIQQLRDSAISSNKTPHNSS
MAHIESVLQQLDEAQGQMEELFQERKIKLELFLQLRIFERDAIDIISDLESWNEELSQQM
SDFDTEDLTLAEQRLQHHADKALTMNNLTYDVIHQGQELLQYVTEVQASGVELLCDRDVD
MATRVQDLLEFLHEKQQELDLAAEQHRRHLEQCVQLRHLQAEVKQVLGWIRNGESMLNAG
LITASSLQEAEQLQKEHEQFQHAIEKTHQSALQVQQKAETLLQANHYDMDMIRDCAEKVA
DHWQQLMLKMEDRLKLVNASVAFYKTSEQVCSVLESLEQEYKREEDWCGGADKLGPNSES
DHVTPMISKHLEQKEAFLKACTLARRNADVFLKYLHRNSVNMPGMLSHVKAPETQVKNIL
NELLQRENRVLHFWTMRKRRLDQCQQYVVFERSAKQALEWIHDTGEFYLSTHTSTGSSIH
HTQELLKEHEDFQITAKQTKERVKLLIQLADGFCDKGHAHALEIKKWVSSVDKRYRDFSL
RMDKYRTCLETALGISSDSNKASKELQLDIIPASAPGSEVKLRDAAHDLNEEKRKSARRK
EFIMAELIQTEKAYVRDLRECLDTYLWEMTSGVEEIPAGIVNKEHIIFGNMQDLYEFHHN
IFLKELEKYEQLPEDVGHCFVTWADKFQMYVSYCKNKPDSTQLILEHAGAYFDEIQQRHR
LANSISSYLIKPVQRITKYQLLLKELLTCCEEGKGEIKDGLEVMLSVPKKANDAMHLSML
EGFDGNIDSQGELILQESFQVWDPKTLIRKGRDRHLFLFEMSLVLSKEVKDSNGRSKYLY
KSKLFTSELGVTEHVEGDPCKFALWVGRTPTSDNKIVLKASSIENKQDWIKHIREVIQER
IVHLRGALKEPIHIPKTTTAKHKGRRDGEELDSQGDASSQPDTISIASRTSQNTMDSDKL
SGGCELTVVIHDFVASNGSSGELSVRRGQTVEVLERLHDKPDWCLVRTTDRSPAQEGIVP
CSMLCIAHSRSSMEMEGLFNHKDTLSVSSNDALQPGSSQTLGPHSSPGPKRPGNTLRKWL
TSPVRRLSSGKADGHVKKLAHKHKKNREGARKNMDAMHGSQKDSDDSAATPQDETLEERM
RNEGLSSGTLSKSSSSGMQSCGEEEGEEGADAVPLPPPMAIQQHSLLQPDSQDDKSGSRL
SARPSSSETPSAAELVSAIEELVKSKMSLEDRPSSLSVEQGDSSSPSLNPSDNSLLSSSS
PIDEMDERKADFLKRRHYVLLELVETERDYVRDLGSVVEGYMCRMKEEGVPDDMRGKDKI
VFGNIHQIYDWHKDFFLGELEKCLEDPDRLAPLFIKQERRLHMYIVYCQNKPKSEHIVSE
YIDTYFEDLKQRLGHRLQITDLLIKPVQRIMKYQLLLKDLLKMSKKAGLDMAELEKAVEV
MCVVPKRCNDMMNVGRLQGFEGKIVAQGRLLLQDTFMVSDQDGGLLSRMKERRVFLFEQI
VIFSEPLDKKKGFSTPGYLFKNSIKVSWLGLEEHSEDPCKFTLTSRSSSGNLERYTLHSM
SPGVSQVWVHQISQILENQRNFLNALTSPIEYQRNHVGSGVPGGLPSSSSSSTGGLPGGS
SSIGSSSMGVGGGGGSGGPGNSSSSSLCGPRSRPSRIPQPSSRLPQPVHHHHPPGPDGPD
RSAGMWPPCHPQSHPSNSYSDRATNGEPLGSEFPKMKRLELHGNNSNNSNKSSDSYEDTQ
KHPAAGIPQMAVAPLNLTLKSPRVGTVSPLISPQSPAGGKEAFIPSSQAHKGNLFWAVVP
PMPSSVSSRPSSLSYPSDSVGGGDSLGRGGHCTPSHHRQSTHSKDIDRMSTCSSTSEQSI
QSIQSNGSENSSSSIVSTMLVTQDYVAVKEDEISVVQGEVVQILASNQQNMFLVYRAANE
HSPAAEGWIPGYVLGHTSSSVTPELPEGTIKKSLSWHTALRIRRKSEKRDKEGRKIENGY
RKSQDSLANKVSVKLLNPNFIPDAPPEFLIPVTDVACESGDTVTLRCKICSRPRATVTWR
GPDNGVRSNNGRYSTTYSETEEATLRIVMVSVEDSGVYTCVATNVAGSVTSSANLTVSAS
HDGNSEIWKSSFEFNYTEITELGRGRFSVTKRCDQRGSKRTVAAKYVSKKLLRREQVLQE
IRLLQTLDHPNLVKLLDTYEMANSYVLVLEMADQGRFLDYVVSWGNLTEEKVALYLREIL
EALHYLHGWRIAHLDLKPENIVVEHASSQPVIKLTDFGDAVQLNPASSYIHPLLGSPEFS
APELVLGQPSSLTSDIWSLGVVTYIVLSGASPFLDESLEETCLNICRLDFSFPEDYFQGV
SLAAKDFVCLLLQSEPERRPTALACLQEQWLQPRGVINTGFLDTSRLISFIERRKHQNDI
RPIDTVRAFLHSRLLNNI
Download sequence
Identical sequences H2TLH2
31033.ENSTRUP00000025527 ENSTRUP00000025527 ENSTRUP00000025527

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]