SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000025547 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000025547
Domain Number 1 Region: 18-116
Classification Level Classification E-value
Superfamily SH2 domain 4.85e-21
Family SH2 domain 0.00072
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000025547
Domain Number - Region: 109-155
Classification Level Classification E-value
Superfamily SOCS box-like 0.0201
Family SOCS box-like 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000025547   Gene: ENSTRUG00000010148   Transcript: ENSTRUT00000025651
Sequence length 157
Comment pep:novel scaffold:FUGU4:scaffold_40:493007:493658:1 gene:ENSTRUG00000010148 transcript:ENSTRUT00000025651 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
THLRPFSSLAQYKLVRTTYVQLLHSDYYWRSMTMEEAHRILASAQLGTFLIRDSCQPDIF
FTLSYQSDEGPISIRIQLNDLLFSLCGSQRTFTSLFSLLAYYSSSSCKLTTPYRKQRPEL
LKQMCRRALIRTYRAEDLLLPGLSKIKDYVLAYPYCI
Download sequence
Identical sequences H2TLJ2
31033.ENSTRUP00000025547 ENSTRUP00000025547 ENSTRUP00000025547

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]