SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000025762 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000025762
Domain Number 1 Region: 15-281
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.53e-91
Family Calponin-homology domain, CH-domain 0.00000302
Further Details:      
 
Domain Number 2 Region: 301-421
Classification Level Classification E-value
Superfamily Spectrin repeat 5.23e-33
Family Spectrin repeat 0.0000729
Further Details:      
 
Domain Number 3 Region: 607-746
Classification Level Classification E-value
Superfamily Spectrin repeat 2.28e-31
Family Spectrin repeat 0.00038
Further Details:      
 
Domain Number 4 Region: 1015-1172
Classification Level Classification E-value
Superfamily Spectrin repeat 9.6e-28
Family Spectrin repeat 0.0000333
Further Details:      
 
Domain Number 5 Region: 2231-2346
Classification Level Classification E-value
Superfamily PH domain-like 1.73e-27
Family Pleckstrin-homology domain (PH domain) 0.0000847
Further Details:      
 
Domain Number 6 Region: 1228-1381
Classification Level Classification E-value
Superfamily Spectrin repeat 1.9e-26
Family Spectrin repeat 0.00044
Further Details:      
 
Domain Number 7 Region: 1486-1607
Classification Level Classification E-value
Superfamily Spectrin repeat 5.23e-25
Family Spectrin repeat 0.00031
Further Details:      
 
Domain Number 8 Region: 1564-1704
Classification Level Classification E-value
Superfamily Spectrin repeat 8.11e-23
Family Spectrin repeat 0.0014
Further Details:      
 
Domain Number 9 Region: 1661-1810
Classification Level Classification E-value
Superfamily Spectrin repeat 6.48e-22
Family Spectrin repeat 0.0019
Further Details:      
 
Domain Number 10 Region: 430-532
Classification Level Classification E-value
Superfamily Spectrin repeat 7.2e-21
Family Spectrin repeat 0.00035
Further Details:      
 
Domain Number 11 Region: 1868-2023
Classification Level Classification E-value
Superfamily Spectrin repeat 7.2e-21
Family Spectrin repeat 0.0027
Further Details:      
 
Domain Number 12 Region: 821-955
Classification Level Classification E-value
Superfamily Spectrin repeat 8.2e-21
Family Spectrin repeat 0.0035
Further Details:      
 
Domain Number 13 Region: 534-641
Classification Level Classification E-value
Superfamily Spectrin repeat 8.38e-20
Family Spectrin repeat 0.00065
Further Details:      
 
Domain Number 14 Region: 750-851
Classification Level Classification E-value
Superfamily Spectrin repeat 8.48e-19
Family Spectrin repeat 0.001
Further Details:      
 
Domain Number 15 Region: 1383-1497
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000461
Family Spectrin repeat 0.0012
Further Details:      
 
Domain Number 16 Region: 2006-2090
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000131
Family Spectrin repeat 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000025762   Gene: ENSTRUG00000010227   Transcript: ENSTRUT00000025866
Sequence length 2393
Comment pep:novel scaffold:FUGU4:scaffold_158:171734:188043:1 gene:ENSTRUG00000010227 transcript:ENSTRUT00000025866 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAAMTSTTDFDNAEITQQYSHINTRFNLLDEELDNDNSSARLFERSRIKALADEREAVQK
KTFTKWVNSILSRVGCRISDLYLDLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVD
KALQFLKEQRVHLENMGSHDIVDGNHRLILGLIWTIILRFQIQDIIVETGQADQKETRSA
KDALLLWCQMKTAGYPNVNITNFTTSWKDGMAFNALIHKHRPDLVDYSSLKRSNPTHNLQ
NAFNAAEQNLGVTKLLDPEDVFTENPDEKSIITYVVAFYHYFSKMKQLAVEGKRVGKVLE
QAIETEKMVEKYETLASDLLMWIEQTIAVLNNRKLTNSLTGVQQQLQAFNTYRTVEKPPK
FQEKGNLEVLLFTIQSRMRANNQRVYTPKEGVLVADINKAWSRLEKAEHDRERVLRDELI
RQEKLEQMARRFDRKAAMRETWLLENQRLVAQDNFGYDLSAVEAAKKKHDAIETDIAAYE
ERVQALVNISKELESERYHDAKRIDVRKDNVLRLWDYLQELLKARRGRLDKNLTLQRIFQ
EMLYIIGWMDDMKARLMSPDFGKHLLEVEDLLQKHTLLENDIALQAERVQNASAAALTFA
NGDTYKPCDPQVIHDRVQHLNLCYQELCSLATQRRARLEQSRRFWNFLWEVVELDGWIRE
KEHIFSSLDYGKDLTSVLVLQSKHSAFEDELGARRANLEQVLAEGEKMIQSKHFGSPKVQ
ECMDNIQRQWQQLEELAAFRKQNLQDTQRFFQFQGDADDLKAWLLEAKRQMSSDDVGHDE
YTTQRLLKKHNTLKNQAIKNGATIDALTKQANALPEELHNTPDIQRRLKDIKDLYMELMS
LSDLRQKKLDDTMALYTIFSETDACELWMGQKETWLVDLEVPEKLEDLEVVQNRLSILAQ
DMGNMQVRVEDVNKAVKQLEDSRHPRTKEVKECQARLNKRWEAFKAMVEDKKRKVDSAVS
LNNYGLECDETDAWIRDKTRVIESTQDLGNDLAAVMTIQRKLFGMERDLAAIDAKLNFLR
NEADQLAKDQPENAGDILKHRGELENSWDNLKKTLKGREASLGEVSKLQTFLQDMDDFQS
WLFKTQKAVASEEMPATLPEAEEQLNLHDAVREDISNHEEDYHRVRDTGAQVTQGQEDDP
QYQQLEQRLNGLDRGWYELQKMWDSRKNFLDQGLGFQQFMRDCKAVEAILNNQEYTLAHI
DKPDTLAGAEKALKKHEDFESTMEANEDKIDGTLQSGQRLVDSNNLYSGKIQDKMDSIKD
RHSKNKSRAQEVSQKLRDNRDLQHFLQNTQDLTLWINEKMLTAQDTSYDEARNLHSKWLK
HQAFMAELASNKGWLDKVDQQGQALMETKPEFEPIVKERLAKLHELWDKLESTTQEKARL
LFDANRSELFDQSLADMKKWLGELQQQLQSGDEEVKDLTNANILLKKHQMTENQVRDRAR
ELEELQEAVSKHGGAREDQPELEAEQQALQREFQQLLTPLDQRRGKLEASKAVHQFYRDL
ADELLWIEERMPLAMSQEHGHNLQTVQMLLKKNQTLQREIEGHQPRVDDVLERGRRMASA
ADAEGRPEAERITEQLEELEKAWAWLQDEMAKRRERLKGSNMAQQYYNDADEAEAWIGEQ
ELYMIADEKAKDEQSAMLMLKRHTVLKHAVDDYADSIRKLSDRAQRMFTEEHLQGEEIIR
RQGQVDKQYAGLKELAEDRRKKLDHTYHHFLLNREVEDLEHWISERDVVASSQEMGQDLD
HVMLLRDRFREFARETGMVGQERVDFVNLTIDELIEAGHAEAATMAEWKDGINESWADLL
ELIDTRTQLLTTSYELLKYFDDGTELVAQIHDKLKELPDDVGEDFSKAESFHRMHAAFER
DITALGKQVQQFQETASRLHAQYAGGRAESIQAREREVVEAWKCLLDACDGRRAQLVDTA
DKFRFFTMVRDLMAWMESIIQQIEAQEEEKPRDVSSVELLQKYHQGISEIEARGAKFTDC
ADLGKALLTRKHRDSAEIKEKLLQLNEKQEMMMLKWDDRWDWLRLLLEVCQFARDASVAE
AWLIAQEPYVTSRDLGFTADQVEKLLKRHEAFEKSTAAWEERFSALERLTTLELMELRKQ
QQDIEDFLKQEQRSDSSAGVAAGDLGRGTTRASEKNPRSLTPWRSPPWSVCPTGTSVFRT
RSGLSHAPPTFCLRQSAAVEPGTDAADATAAESTLPIESMKESGSLELEPSVSLALPAEP
EKAATMPVEASRAQTVLQEGPLGRKHDVEGSGKKSSNRSWNNLYCVLKPGQLSAYKDAKS
FGHGATYHGEEPLALAGAHWEVLTNYKKKKHVFKLRLGDASEYLFQCKDEEELQRWSQAM
HTAIQQPTAEPSGPPEARAQTLPAPFTHSPPPPEPSSTKKDKEKKFGRFAKKK
Download sequence
Identical sequences H2TM56
ENSTRUP00000025762 31033.ENSTRUP00000025762 ENSTRUP00000025762

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]