SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000025795 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000025795
Domain Number 1 Region: 1327-1465
Classification Level Classification E-value
Superfamily PRC-barrel domain 3.06e-61
Family RIKEN cDNA 2310057j16 protein (KIAA1543) 0.00000141
Further Details:      
 
Domain Number 2 Region: 207-299
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000000000136
Family Calponin-homology domain, CH-domain 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000025795   Gene: ENSTRUG00000010238   Transcript: ENSTRUT00000025899
Sequence length 1470
Comment pep:novel scaffold:FUGU4:scaffold_43:1342227:1362661:1 gene:ENSTRUG00000010238 transcript:ENSTRUT00000025899 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YDFSRAKISCSLTWLVAKAYGTDCIPADLKEPFYTDQYDQEHLKPPVASLLLSADLYCRA
GSLILKRDAAKPLLGHDAVIQALAQRGLYVTDQDRMVTERDLRKRPLQMSAHLAMIDTLM
MAYTVETASAEKVMACIRQYSCGSTEEETPYDTEDVVTTWINTVNEYLKEIVTQEQRREA
QGAEPAGSPRARYRKEQASAQPVPWIPPVDNLLKDSTDGSALAVLLHFYCPQLLQLSDVC
LKENMTLADRLYNLQLIQEFCKDNLNDCCHFTLEDMLYASSTIKNNFLVFMAELFWWFEV
VKPSFVKPRLLSNEYADPSSVLKNIPVIPISKATKRSFMERPPSPERPRYSASKSKYLSC
RKYLNGKSVNTNLQCIYLLNFSVISSKCPVCRSDLNLETQVICMIFHSFIHLRFLNYYHC
STTCTHKIRNTVAGTQTDLGEIKRSTSMSFVEGNLGTWPKEKRFVTCRLCRSSALFGITL
LRQSNVMVPFRSGPYGVSFDIPFDKDSSTSVPLSSTRGMIRSVSTDDGSGFKVQHLPRGM
KRNLSFQPVNGTKVIGIAEEGCPDSLAGVEPESVYPNGQGSFVATTPSMEEALQIIHSPT
RPVVEGIQNGFFLHSQDHGAGGLEPVSESDSKEVLSTTDTTEVDTGIHIRTEDMLDEDSS
LKDCSVNMDLDMDSPSPCASSLSKSPSGLKMTCFAEQKLKKHTPDSGRCSSSSLKTTPEG
SDFGAPLSVSWAPTPEHSPVRQQAAPSPVQLPASDPAQAMATEMVQLRMRLEEKRKAIEA
QKKKVEAAFTRHRQKMGHSVFLNVVKRKGDGAASGEEARKSEGEGKAASPILKFGRSKAD
TPDGAEQSSPGCWTKSPGVGEESGQSHAQLTELDLTEYTRSIEKLNHSLAFLQAEMQRLS
QQQEVIMAMREQQHQQAWVIPPPHTNPSPQRHSRAGAVTRSSGPSSPVDSPLPSHRSPNS
IKRKSASFHSRNPRTARPSELKLAPYNRVLTAPQSVDSIPRLRRFSPCQPLACSFAYMEE
KPAPNPAPVATDGDRKAASTQAQDTDCQPKTTGTEKDQDLDLKPTMESSFPEVLSHLVTE
TFTVAPTEMPPQPEASGQAKSSLIEVPLSVVKPPEGLTPEDGLERQQDNTEDSDGDQKMC
RGFFFKEDGKAEENMAQKRAALLEKRMRREKESLQKKMQLEAELEQKKEEARLKAEEERL
RKEEDKARREFIKQEYLRRKQLKLMEDMDAVIKPRASGGAKQRRGRPKSIHRDSLDSPKT
PVRAATVCSLSLASLNLGDSDSVHSDLTLCSRPDSADGFLSPSRSSSRNGEKDWENGSTT
SSVTSNTEYTGPRLYKEPSAKSNKHIIQNALAHCCLAGKVNEGQKNKILEQMEKCEANNF
LILFRDAGCQFRSVYTYCPETEDITRLAGIGPKSVTRRMIDGLYKYNSDKKQFSQIPAKT
MSASVDAVTIHNHLWQTKKPATPKKVVPAQ
Download sequence
Identical sequences H2TM89
ENSTRUP00000025795 ENSTRUP00000025795 31033.ENSTRUP00000025795

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]