SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000026384 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000026384
Domain Number 1 Region: 824-930
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.36e-30
Family Calponin-homology domain, CH-domain 0.00018
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000026384
Domain Number - Region: 930-966
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0173
Family Calponin-homology domain, CH-domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000026384   Gene: ENSTRUG00000010473   Transcript: ENSTRUT00000026491
Sequence length 977
Comment pep:novel scaffold:FUGU4:scaffold_50:244866:269348:1 gene:ENSTRUG00000010473 transcript:ENSTRUT00000026491 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLQDQLGGLHQSSFQNPLLDGTVDLDERRLIRSAIRELRRREIEDMEAALATKRFRPTRL
KLQEDKENQHRSESAEKLDVLSKKLQSVQDIDELTKMLRAASEYEERKMIRAAIRKIRDE
QQQGRQRHTNAHKQYFGLPNSNGRPDFKRLTAEREGGSRSRDREREQGAGFAQPPGKTKQ
GTAEKRSVLTVWSRSKPEAQQLCFFKPQLSGTEAGLEEMPTSPHVSTCLLSDCSQKSEPS
ASDPSMSSVLSTSSLDCMATEKSLGSAYRARLDSAASDKSQSSSQRSRVNSGASEQSVDS
YIRARLGSDVLGSNIAPGFDSDTSINLIGLSRKRSDSGASSHSGSTTSEEKGPTQEVETF
TPKKERGPLLHSKHNSVMLLKIMVPYPAKEARPICQELPRGVANKPLSSAGQWHNSVGGT
RHPAEKDARASSQSKEDEAPGRAAGQQVTQGEATDQDMKTFLTVEIKDGRAGASSTPSTR
GNIVPITNMTPRITTNALGQRAELTLGLRATPFKTTSSSLSSGSSIKHRVDDPPARTLVE
IPSSSHQESISHSQDYSKGSRTFEMETEPVVASEPVPRHVPAIPNGSNTQTKPDEHPGKM
TMEQLAAIEDEELLDKMLDESKDFEERKMIRAAMRDLRKRKRDQREKERDTRLQELRQQR
EERSQKGRAGAGAGEMVMRKVEKSADGSSLSQITKTDRFTHCDDGSRSSRSTVVEASYIQ
KTDRGTVQSKSYSFTSSSSSSSSSSFNTSKKVGSVFDREDDTSSRGGGGGLAAIERRQAE
RRKELMRAQTLPKTSAMQARKAMIEKLEKEGGGPGNQAVAKVNKVQRSTSFGVPNANSIK
QMLLDWCRAKTRSYEHVDIQNFSSSWSNGMAFCALVHNFFPDAFDYSSLSPSNRRQNFEV
AFSAAEKLVDCPQLLDVDDMVKMREPDWKTYAKCMPLLEVEDMMIMGNKPDSKCVFTYVQ
SLINHLRRHEMSMGRPC
Download sequence
Identical sequences H2TNX8
31033.ENSTRUP00000026384 ENSTRUP00000026384 ENSTRUP00000026384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]