SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000026774 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000026774
Domain Number 1 Region: 2-128,163-215
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.63e-35
Family Nucleotide and nucleoside kinases 0.00000163
Further Details:      
 
Domain Number 2 Region: 128-164
Classification Level Classification E-value
Superfamily Microbial and mitochondrial ADK, insert "zinc finger" domain 0.00000000000353
Family Microbial and mitochondrial ADK, insert "zinc finger" domain 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000026774   Gene: ENSTRUG00000010606   Transcript: ENSTRUT00000026882
Sequence length 226
Comment pep:known scaffold:FUGU4:scaffold_413:150284:153081:1 gene:ENSTRUG00000010606 transcript:ENSTRUT00000026882 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VMSLPKIFRVIIMGPPGSGKGTVSARIIKSFLLKHISSGDILRANINAKTELGLLMKSCI
DQGQLVPDDVISRLILKDLRALENSSWLLDGFPRTVSQAEALEDAYSVDSVLNLNVPFQT
IKERLTSRWTHFPSGRVYNIDFNPPKVPGLDDVTGEPLVQRDDDSPETVTRRLRSYETQT
EPVLEFYRCKGVLQTFSGTETNKIWPHVEAFLHKKFPSIQQGSVTA
Download sequence
Identical sequences H2TQ17
31033.ENSTRUP00000026774 ENSTRUP00000026774 ENSTRUP00000026774

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]