SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000026830 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000026830
Domain Number 1 Region: 10-121
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.32e-20
Family Calponin-homology domain, CH-domain 0.001
Further Details:      
 
Domain Number 2 Region: 1007-1106
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000000101
Family PDZ domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000026830   Gene: ENSTRUG00000010628   Transcript: ENSTRUT00000026938
Sequence length 1645
Comment pep:novel scaffold:FUGU4:scaffold_31:212186:245109:-1 gene:ENSTRUG00000010628 transcript:ENSTRUT00000026938 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FFLQAVTKKTFGSDDFRSALENGILLCDLINKIKPGTIKRINRLPTPIAGLDNLNVFLRA
CGKLGLKDAQLFHPGDLQDLSSRVTVKDQETNRRLKNVLITIYWLGRRAQCDQLYDGPYL
NFKAFEGLLGTALYKALHESPSLRDSSIRDSGFGDSWYSEREEPPHFRGAQAGGGGSVHK
RDNSLDSLNSLSSQAHSISSDTTIKGSSEGCCSDTEADSVFKMTDNTQNISYRRSVSITP
KATAPFNQFLPSKDKSSGYVPAPLRKKRAERNEDIRHSWTSASTEEDRILTRFDLLSLLS
SSGETQPPKCGSVKVDHLKNDEDDEVGYADPIQDDLYARKMGIKSQPFGNECHNQFLPKL
WTPEEDFHIQKIKTGSQRRPWYKKIQGFSIYLHCSHLQDDFFFHTPPLVFAPMDPTSGPK
LVKCQRWPIFGRKDLPEPPDTFDYESVVPDLENDDMFTRRTLTFQSNMNLAMAKTQLPSR
RRLCTSDPQLNIITQKHKHGIPQVGDFPDIEMDDVVYRKEKTQQAQQQRPLSGAPDNYAP
MPIPEPWALPPDLKARLLCPPCPLTQEEAASNQDQVEKDTYLPTDDMLIRKLGNCPEDCK
SSLTGPPANPLTPSVTLSCCEADLQRWQAIREASQLRYKKRLMVERLAGGIWGNFMSKST
NDIQLPVDAGARRYEQLQNFRDQIKESESQWQDDLSKWKNRRRSVNSDIVKKKEEREKIE
QITSSDNYSRRSKTFREMQDERSQTIDTPYYSYDTHDRSLKQDEPPTASTATGRAASPPT
SRLGPSYSDTAKTEKTTTAASSFSSVQKVREPTRPLLRTKAEVEIPSSKHQPQPSSMESN
PPALSRVSASLPRSYQRSDSARLTSVVAPRPFGAQTSRITSLPRAFTVDDPQSRVNGDGS
KKSAAPSRYQQFMTSEDEADSSSAHSSNEEEEEEEEVEKDRTTVTSTSVSTVLPPVKDEA
LVSSAPVFSSEHFLLSNYKNSKNSKNIRMICDVQESHCEMRISLNQKPNSSRDFGFQAVW
DSTGARVMSVQPGTGSQAEMCQLQSGDEVLTVNRHQVAEMSYTDWKSRMEEALQEGSLVM
DIRRHGKDKKSSVNPSLDFTSRVSTDTQAPREPPTRTVIVSETQSLQGNDVASSGVNGGF
CEEPLNMRNKESESISLKNLKRRSEFFEKGGPEAVMPDILVPPIVPPASRWSWDPEEERR
RQEKWQKEQERLLQEKYKRDQEKLQAEWLKAQQEIAKNTEQQQPRTLEVNSQSPVSISPR
APLSPLKQATSHPWEEEERKRKEEQEQQWQAGRRRREEEEREQQRLQAERRRREEEEREQ
QRLQVERRRKEEEEEQERQRLQAERRRKEEEEERERQQLQAERRRKEEEYVINCFQQSLL
GFFLFIDRMKSKSTPQLDQDEKTPWKANSRAVGDSRGQQPPTQANVERQQILNEMKKKIP
LLTDSSWIRQGSSSTASNVRETNLPPMRRGESLDNLDAPSTWRSSWTPRSNSFVPNHNPL
PSAFSGSDVISSGGSGVQRPSTLPTSYSVGHLRGGAGTPSFPSSKQSPLPSPLSPTRSPE
PWNNAGSRSVSGKKICTFCDIPLGKGAAMIIESLGLCYHLSCFKCFDCKAELGGSEAGAE
VRIRNKQLYCNLCYMRFKTATPTEM
Download sequence
Identical sequences H2TQ73
31033.ENSTRUP00000026830 ENSTRUP00000026830 ENSTRUP00000026830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]