SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000027304 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000027304
Domain Number 1 Region: 366-484
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.37e-33
Family Calponin-homology domain, CH-domain 0.0000948
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000027304   Gene: ENSTRUG00000010815   Transcript: ENSTRUT00000027413
Sequence length 486
Comment pep:novel scaffold:FUGU4:scaffold_181:373849:385502:1 gene:ENSTRUG00000010815 transcript:ENSTRUT00000027413 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ADMGDLCHPRSSSPEGETVCAALARYESTLRDAIREIHVDVSAFKLGMERRLEETANLSG
PLGRAVLHLQQENRQLRVQLEALARQVELLGGMSCERNTVLNNSHYHSSSRGSSSPPVGS
KATAVTSGPVSGSSPSPARFSSRATFAVCSKNNSIEKEEPIEVDHAPTHAGLENGHSTEQ
SVLVHGKISPPSDRRHGHAAPVATPHLPITATTKVAEIKRPGSPGSPAGSPPSPASEESP
LSQSAAGAKQSPPPTGEPAPAVFLSVPSSWTSTPARSLGSPRLQERASSAKSVTYSGLLH
DRDGPSSCDRSFGPVGDRRRELVRSQTLPRNIGAQARRSIFQRLEADAGNSNSRPLAVDS
KPKLKRSQSFGVSSASSIKQILLEWCRSKTVGYQNIDIQNFSSSWSDGMAFCALVHSFFP
TEFDYDSLSPANRKHNFELAFGTAEAKAGCDRLIEVDDMMIMGRKPDPMCVFTYVQSLYN
HLRKFE
Download sequence
Identical sequences H2TRJ7
31033.ENSTRUP00000027304 ENSTRUP00000027304 ENSTRUP00000027304

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]