SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000027442 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000027442
Domain Number 1 Region: 249-446
Classification Level Classification E-value
Superfamily Phosphoglycerate mutase-like 1.37e-57
Family 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, phosphatase domain 0.000000232
Further Details:      
 
Domain Number 2 Region: 34-247
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.3e-41
Family 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain 0.000000103
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000027442   Gene: ENSTRUG00000010861   Transcript: ENSTRUT00000027551
Sequence length 536
Comment pep:novel scaffold:FUGU4:scaffold_168:461204:465053:1 gene:ENSTRUG00000010861 transcript:ENSTRUT00000027551 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRELTQNRIQKIWIPNKDGKPAPRRAGAPHFANPPTVIVMVGLPARGKTYISKKLTRYL
NWIGMPTKVFNVGEYRREAVKNYSSYDFFKPDNECAVKIRQQCALAALRDVKSYLKDEGG
QVAVFDATNTTRDRRAMILNFSAENDFKIFFIESVCDDPSVIASNIMEVKVSCPDYRDCN
KTDAMLDFQKRIECYKTSYQPLDPDQHDRDLSFIKVIDVGRRYLVNRIQDHIQSKIVYYL
MNIHVQPRTIYLCRHGESTDNLEGRLGGDAGLSPRGQQFSVALAQFMKEQQLKDLKVWTS
QLCGAIQTAEHLGGVYEQWKVLNELDAGLCEEMTYDEVKEKFPEEFALRDEDKYYYRYPA
GESYQDLVQRVEPVIMELERQENVLVICHQAVMRCLLAYFLDKSAEEMPYLKCPLHTVLK
LTPVAYGCKVESIYLNVEAVNTHRDRPEEVKRGPGTLIRRNSVTPLTSPESHIKKPRIDE
LDEPPIQELPPSVASLALCSPSHPSLALTGQHWLGKVCLRTTFQYLKVISLLVFQR
Download sequence
Identical sequences H2TRY4
31033.ENSTRUP00000027442 ENSTRUP00000027442 ENSTRUP00000027442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]