SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000028024 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000028024
Domain Number 1 Region: 30-259
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 9.75e-86
Family Calponin-homology domain, CH-domain 0.0000192
Further Details:      
 
Domain Number 2 Region: 277-399
Classification Level Classification E-value
Superfamily Spectrin repeat 1.78e-32
Family Spectrin repeat 0.000000564
Further Details:      
 
Domain Number 3 Region: 513-634
Classification Level Classification E-value
Superfamily Spectrin repeat 8.64e-32
Family Spectrin repeat 0.00000285
Further Details:      
 
Domain Number 4 Region: 400-509
Classification Level Classification E-value
Superfamily Spectrin repeat 2.36e-24
Family Spectrin repeat 0.00000393
Further Details:      
 
Domain Number 5 Region: 637-749
Classification Level Classification E-value
Superfamily Spectrin repeat 4.58e-24
Family Spectrin repeat 0.00000263
Further Details:      
 
Domain Number 6 Region: 742-869
Classification Level Classification E-value
Superfamily EF-hand 3.93e-22
Family EF-hand modules in multidomain proteins 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000028024   Gene: ENSTRUG00000011100   Transcript: ENSTRUT00000028134
Sequence length 897
Comment pep:novel scaffold:FUGU4:scaffold_246:265034:288940:1 gene:ENSTRUG00000011100 transcript:ENSTRUT00000028134 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WTHQPSQINASNMEQYDGEECYMQQQDDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGT
QIENIEEDFRDGLKLMLLLEVISGERLAKPERGKMRVHKISNVNKALDFIASKGVKLVSI
GAEEIVDGNAKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNIQNFH
ISWKDGLGFCALIHRHRPELIDYGKLRKDDPMTNLNTAFDVAEKYLDIPKMLDAEDIVGT
ARPDEKAIMTYVSSFYHAFSGAQKAETAANRICKVLAVNQENEQLMEDYERLASDLLEWI
RRTIPWLENRMPENTMQAMQQKLEDFRDYRRLHKPPKVQEKCQLEINFNTLQTKLRLSNR
PAFMPSEGKMVSDIINAWGNLEGAEKGYEEWLLNEIRRLERLDHLAEKFRQKATIHEAWT
EGQEEVLQKHDYETASLSEIKALLKKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSP
SVNARCQRICDQWDTLGALTQKRGEALQRTGKLLETIDQLYLEFAKRAAPFNNWMESAME
DLQDTFIVHTIEEIQGLSTAHEQFKATLPEADKERQAILGIHNEIAKIVQTYHVNMAGTN
PYTTITPQEVNTKWDKVKQLVPQRDQALIEEHARQQNNERLRRQFANQANVIGPWIQTKM
EEIGRISIEMHGTLEDQLQHLRQYEKSIVNYKPKIDQLEGDHQLIQEALIFDNKHTKYTM
EHIRVGWEQLLTTIARTINEIENQILTRDAKGISQEQLNEFRASFNHFDRKRSGIMDAED
FKTCLISMGYNLGESEFSRIMSVVDPNRMGLVTFQAFIDFMSRETADTDTADQVIASFKV
LAGDKNYILADELRRELPPDQAEYCIARMAPYTGPDGVPGALDYMSFSTALYGESDL
Download sequence
Identical sequences H2TTL6
ENSTRUP00000028024 ENSTRUP00000028024 31033.ENSTRUP00000028024

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]