SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000028635 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000028635
Domain Number 1 Region: 1-175
Classification Level Classification E-value
Superfamily p53-like transcription factors 2.92e-59
Family Rel/Dorsal transcription factors, DNA-binding domain 0.00000459
Further Details:      
 
Domain Number 2 Region: 176-294
Classification Level Classification E-value
Superfamily E set domains 2.8e-39
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.0000574
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000028635   Gene: ENSTRUG00000011348   Transcript: ENSTRUT00000028751
Sequence length 302
Comment pep:novel scaffold:FUGU4:scaffold_9:882957:884563:1 gene:ENSTRUG00000011348 transcript:ENSTRUT00000028751 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PKLVVVEEPKERGMRFRYECEGRSAGSILGASSTETNKTQPAVEIQGPIDHLKKVTITVS
LVTKDPPHRPHPHCLVGKDCPEGSDAVSHSSLFCLCSFTNLGIQCVRRKELDMSLQKRRS
QNIDPFQTGDSRGIEDMDMNAVRLCFQCDLEWDDGRNDSLSPVVSSPIYDKKATTTSQLK
ITCLNQYRGSCAGKTEIYMLCDKVQKDDIEIIFRQDSWKANGEFAQTDVHRQIAIVFKTP
PYQDQDITEEVEVSVLLRRISDQMESEPIKFTYLPHNPGECGKPTERRRCYGRLTCVCLS
SP
Download sequence
Identical sequences H2TVC6
ENSTRUP00000028635 31033.ENSTRUP00000028635 ENSTRUP00000028635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]