SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000029424 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000029424
Domain Number 1 Region: 35-134
Classification Level Classification E-value
Superfamily SH2 domain 4.17e-23
Family SH2 domain 0.00042
Further Details:      
 
Domain Number 2 Region: 152-200
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000000772
Family SOCS box-like 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000029424   Gene: ENSTRUG00000011640   Transcript: ENSTRUT00000029541
Sequence length 201
Comment pep:known scaffold:FUGU4:scaffold_115:763951:765890:1 gene:ENSTRUG00000011640 transcript:ENSTRUT00000029541 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVTHSKFSNAMSSSLFDSNMRLPHHYKTFNSKSQYQMVLATLHKLQESGFYWGAITGKDA
NVMLAAEDAGTFLIRDSSDNRHLFALSIKTASGTKNLRIQCDSSSFYLQTDPKNIQTVPH
FDCVLKLVHYYMSQSKGSTLYYIYSGAEKVPLELIKPLSCSLSTLQHLCRKTVNGLVDVS
SRRDQLPHHIKEFLQDYDAPI
Download sequence
Identical sequences Q2LD51
NP_001072096.1.43653 ENSTRUP00000029424 31033.ENSTRUP00000029424 ENSTRUP00000029424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]