SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000030008 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000030008
Domain Number 1 Region: 26-281
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.67e-90
Family Calponin-homology domain, CH-domain 0.000000805
Further Details:      
 
Domain Number 2 Region: 297-418
Classification Level Classification E-value
Superfamily Spectrin repeat 3.66e-35
Family Spectrin repeat 0.000062
Further Details:      
 
Domain Number 3 Region: 2213-2325
Classification Level Classification E-value
Superfamily PH domain-like 8.4e-35
Family Pleckstrin-homology domain (PH domain) 0.00000384
Further Details:      
 
Domain Number 4 Region: 1647-1802
Classification Level Classification E-value
Superfamily Spectrin repeat 4.45e-30
Family Spectrin repeat 0.0023
Further Details:      
 
Domain Number 5 Region: 603-742
Classification Level Classification E-value
Superfamily Spectrin repeat 1.08e-29
Family Spectrin repeat 0.00025
Further Details:      
 
Domain Number 6 Region: 1014-1168
Classification Level Classification E-value
Superfamily Spectrin repeat 2.64e-29
Family Spectrin repeat 0.0000239
Further Details:      
 
Domain Number 7 Region: 906-1060
Classification Level Classification E-value
Superfamily Spectrin repeat 2.36e-27
Family Spectrin repeat 0.00092
Further Details:      
 
Domain Number 8 Region: 1541-1697
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-26
Family Spectrin repeat 0.0012
Further Details:      
 
Domain Number 9 Region: 1754-1908
Classification Level Classification E-value
Superfamily Spectrin repeat 6.36e-25
Family Spectrin repeat 0.0024
Further Details:      
 
Domain Number 10 Region: 1229-1378
Classification Level Classification E-value
Superfamily Spectrin repeat 3.31e-24
Family Spectrin repeat 0.00058
Further Details:      
 
Domain Number 11 Region: 427-530
Classification Level Classification E-value
Superfamily Spectrin repeat 1.14e-22
Family Spectrin repeat 0.00034
Further Details:      
 
Domain Number 12 Region: 742-857
Classification Level Classification E-value
Superfamily Spectrin repeat 2.02e-20
Family Spectrin repeat 0.00053
Further Details:      
 
Domain Number 13 Region: 531-637
Classification Level Classification E-value
Superfamily Spectrin repeat 1.19e-18
Family Spectrin repeat 0.00055
Further Details:      
 
Domain Number 14 Region: 1386-1483
Classification Level Classification E-value
Superfamily Spectrin repeat 3.53e-16
Family Spectrin repeat 0.00058
Further Details:      
 
Domain Number 15 Region: 2018-2079
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000034
Family Spectrin repeat 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000030008   Gene: ENSTRUG00000011875   Transcript: ENSTRUT00000030125
Sequence length 2384
Comment pep:novel scaffold:FUGU4:scaffold_121:757908:801026:1 gene:ENSTRUG00000011875 transcript:ENSTRUT00000030125 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FKMTSVASEFEHMDIQQQFNDGVNNRWDTDDWDNENSSARLFERSRIKALADEREAVQKK
TFTKWVNSHLSRVSCRITDLYMDLRDGRMLIKLLEVLSGEKLPKPTKGRMRIHCLENVDK
ALQFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDA
LLLWCQMKTAGYSNVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAF
NLAEQHLGLTKLLDPEDISVDHPDEKSIITYVVTYYHYFSKMKALKVEGKRIGKVLDHAI
ETEKMIEKYESLASDLLEWIEQTIIILNNRKFANSLVGVQQQLQAFNTYRTVEKPPKFTE
KGNLEVLLFTIQSKMRANNQKVFTPREGKLISDINKAWERLERAEHERELALRTELIRQE
KLEQLARRFDRKAAMRETWLSENQRLVSQDNFGCDLQAVEAATKKHEAIETDIAAYEERV
QAVVAVAKELEAESYHDIKRVTARKDNVMRLWEYLLELLKARRLRLEMNLGLQRVFQEML
YIMDWMDEMKMLLLSQDYGKHLLGVEDLLQKHALVESDIAIQADRVRNVNSNAQKFALDV
EDYKPCDPQVIQDRVTHMEFCYQELSQLAAERRGCLEESRRLWKFFWEMAEEEGWIREKE
QILSSEDHGKDLTGAFRLLSQHKALEDEMSGRAGHLQQTIRQGEELVANNHFGADKIKER
IKDIQNQWAALERLSTVRKSHLLEACNKHQFQADADDIDTWMLDILRIVSSVDVGHDEFS
TQALVKKHKDVAEEIGSYRPVIDALHEQSCTFPPEGAGSEAVQIRLAGIEERYKEVVELT
RLRKQALQDALALYKMFSEANACEAWIDEKEQWLNSMEIPEKLEDLEVVQHRFESLEPEM
NNQASRVAVVNQVARQLIHNGHPSEKEIKSQQDKLNTGWSQFRDLADQKKDSLNSALGVQ
NYHLECNETKSWIKEKTKVIESTQELGNDLAGVMALQRKLTGMERDLVAIEVKLGDLGKE
AERLASEHPDQSETIKGRLAEITNVWDEMKDTMKNREESLGEASKLQQFLRDLDDFQSWL
SRTQTAIASEDMPNTLAEAEKLLAQHEGIKNEIRNYEEDYQKMRDMGEMVTRGQTDAQYM
FLRQRLQALDTGWNELHKMWENRQNLLSQSHSYQLFLRDTKQAEAFLNNQEYVLAHTEMP
TTLEAAEAGIKKQEDFMTTMDANEEKIVGVVHAGRRLVADGNINSERIQEKLDSIDQRHK
KNRAAAVALLQRLKDNRDLQKFLQDCQELSLWISEKMLTAQDMTYDEARNLHSKWLKHQA
FMAELQSNKEWLEKIEKDGQTLMLEKPDTETMAKEKLASLKTMWAELESTTQTKAKCLFD
ANKAELFTQSCADLDKWLASLEGQLQSDEYGKDLTSVNILLKKQQILESQVEVRQKEVEE
LQNQSQVLNQEGKGSEEVDGQRVSVERKFHLLLEPLKQRRENLMVSREIHQFNRDVEDEI
LWVEERLPVAMSTDHGHNLQTVQLLIKKNQTLQKEIQGHHPRYTDIFERSQHVLREDGPT
AEPIRQRLTELQLLWQQIREETEKRHKRLSEAHKAQQYYFDAAEAEAWMSEQELYMMSEE
KAKDEQSSVFMLKKHQILEQAVEDYADTVHQLSSTSRGLVAAGHPESERIGMRQSQVDKL
YAGLKDLSEERRGKLDERFRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQER
FREFARDTGSIGQERVDAVNRQADELINAGHSDAATIAEWKDGLNEAWADLLELIDTRTQ
ILAASYELHKFYHDAKEILNRILDKHKKLPEELGRDQNTVETLQRMHTAFEHDIQALGTQ
VWQLQEDAARLQSAYAGDKADDIQKREAEVLEAWKNLLAAAEARRLKLVVTGDKFRFFSM
VRDLMLWMEDVIRLIEAQENPRSDPHSRSRKSYYQKSLKNKKIIVIIKKKFVCVRASAEH
LVKRNYLLRYIVVVLLDRRGDXGKEWENPWEWLXLVLEVHQFSRDASVAESWLLGQEPYL
SSREMGQNADEVEKLIKRHEAFEKSAATWEERFAALERLTTMELLEVRRVQEEGEKKRQA
LPTESLLVDGATQQRDGNVGSQNELASDQDSPRQIISVCKRSQPSAQEMIDKWEDVEPSN
WSSSRSSSTIDPRIGPPLEAPPLDGSPPGSPVATRKGKVNQAATLPAKTQRKLSTSQLES
FLHRKHEWEGHNKKASNRSWHNVYCVINQQEMGFYKDQKNASQGIPYHSEIPVSLKDAIC
EVALDYKKKKHVFKLKITDGNEYLFQAKDDEEMNTWISTISAALSGDKLEVTTSSHSTPA
SAARAQTLPASVTTVTAVAATTESSPGKREKDKEKRFSLFSKKK
Download sequence
Identical sequences H2TZ99
ENSTRUP00000030008 31033.ENSTRUP00000030008 ENSTRUP00000030008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]