SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000030455 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000030455
Domain Number 1 Region: 356-473
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 8.9e-30
Family Calponin-homology domain, CH-domain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000030455   Gene: ENSTRUG00000012034   Transcript: ENSTRUT00000030572
Sequence length 475
Comment pep:novel scaffold:FUGU4:scaffold_82:945493:949354:-1 gene:ENSTRUG00000012034 transcript:ENSTRUT00000030572 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLVQFKNTLQAAIKEVQVDVRAFKEQIVQKMEELSDSSRPLAGVVSRLQEENLQLRAKLE
ALSCLVEGLTGVKVDHSTIECVGPKISQSTSIEPPGPSGGSNASVGTGPSNTSVPPPWRT
RRQAERQIRLYDVTDAVYTKIAPPGMWTPVSPGLMENGTESSLAESSEMIRRSSVPPTSD
LHSQNPDPIKLNKVHHPAPADTKATLEASAGPDSPATTCKVPQKQAAEPDLVCSSQHSSP
AHVQLLNSAEDANEAQLHRPTTATSTKPSSEERFSSKLIQPVADAAEPPKGGSGEHSVKT
AGRKSAWAGTEFKQDVTRAQVPSRPSGAQARRAMFERMNTEPVNRAKESKPKLKRSQSFG
VSSASGIKQILLEWCRSKTIGYQNIDIQNFSSSWSDGMAFCALVHSFFPLEFDYNTLDAR
KRKQNLELAFSTAEKQADCLRLIEVDDMLEMGDKPDPMCVFTYVQALYNHLKKFE
Download sequence
Identical sequences H2U0J6
ENSTRUP00000030455 ENSTRUP00000030455 31033.ENSTRUP00000030455

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]