SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000030656 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000030656
Domain Number 1 Region: 17-278
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 8.35e-91
Family Calponin-homology domain, CH-domain 0.000000934
Further Details:      
 
Domain Number 2 Region: 297-418
Classification Level Classification E-value
Superfamily Spectrin repeat 6.67e-35
Family Spectrin repeat 0.0000642
Further Details:      
 
Domain Number 3 Region: 2219-2333
Classification Level Classification E-value
Superfamily PH domain-like 5.77e-34
Family Pleckstrin-homology domain (PH domain) 0.00000766
Further Details:      
 
Domain Number 4 Region: 1646-1800
Classification Level Classification E-value
Superfamily Spectrin repeat 2.29e-30
Family Spectrin repeat 0.0027
Further Details:      
 
Domain Number 5 Region: 605-744
Classification Level Classification E-value
Superfamily Spectrin repeat 6.48e-29
Family Spectrin repeat 0.00047
Further Details:      
 
Domain Number 6 Region: 1010-1166
Classification Level Classification E-value
Superfamily Spectrin repeat 8.11e-28
Family Spectrin repeat 0.0000243
Further Details:      
 
Domain Number 7 Region: 904-1058
Classification Level Classification E-value
Superfamily Spectrin repeat 2.29e-27
Family Spectrin repeat 0.0012
Further Details:      
 
Domain Number 8 Region: 1858-2012
Classification Level Classification E-value
Superfamily Spectrin repeat 2.68e-27
Family Spectrin repeat 0.0016
Further Details:      
 
Domain Number 9 Region: 1223-1376
Classification Level Classification E-value
Superfamily Spectrin repeat 1.23e-24
Family Spectrin repeat 0.0006
Further Details:      
 
Domain Number 10 Region: 1452-1589
Classification Level Classification E-value
Superfamily Spectrin repeat 2.09e-23
Family Spectrin repeat 0.00028
Further Details:      
 
Domain Number 11 Region: 427-530
Classification Level Classification E-value
Superfamily Spectrin repeat 7.2e-22
Family Spectrin repeat 0.00039
Further Details:      
 
Domain Number 12 Region: 742-855
Classification Level Classification E-value
Superfamily Spectrin repeat 4.03e-20
Family Spectrin repeat 0.00081
Further Details:      
 
Domain Number 13 Region: 531-639
Classification Level Classification E-value
Superfamily Spectrin repeat 1.83e-19
Family Spectrin repeat 0.00037
Further Details:      
 
Domain Number 14 Region: 1384-1482
Classification Level Classification E-value
Superfamily Spectrin repeat 3.66e-17
Family Spectrin repeat 0.00052
Further Details:      
 
Domain Number 15 Region: 2017-2078
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000023
Family Spectrin repeat 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000030656   Gene: ENSTRUG00000012113   Transcript: ENSTRUT00000030773
Sequence length 2386
Comment pep:novel scaffold:FUGU4:scaffold_102:675627:697668:1 gene:ENSTRUG00000012113 transcript:ENSTRUT00000030773 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMTTVASEFDHMELQQQYSSIDTVNNRWDDDWDNENSSARLFERSRIKALADEREAVQKK
TFTKWVNSHLSRVSCRITDLYMDLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDK
ALQFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKRSAKDA
LLLWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLVDFDKLKKSNAHYNLQNAF
NLAEQHLGLTKLLDPEDISVDHPDEKSVITYVVTYYHYFSKMKALKVEGKRIGKVLDHAI
EAEKMIEKYECLASDLLEWIEQTIIILNNRKFANSLIGVQQQLQAFNTYRTVEKPPKFTE
KGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRTELIRQE
KLEQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLQAVEAATKKHEAIETDIAAYEERV
QAVVAVAKELEVESYNDIKRITARKDNVIRLWEYLLELLKARRQRLEMNLGLQRVFQEML
YIMDWMDEMKMLLLSQDYGKHLLGVEDLLQKHALVEADISIQAERVKVVNTSAKKYAITN
EGYKPCDPQVIQDRVSHLEFSYQELTQLAAERRARLEESRRLWKFFWEMAEEEGWIREKE
QILSTDERGKDLTGALRLLSQQRALEDEMSGRAGHFQHTMAEGRAMVEAHHFAATKIQDR
LDDLQAQWAALERLAAVRKNCLEEALVLHQFQADADDVDTWMLDALRIVSSGETGHDEFS
TQALVRKHKDAAAEVSSYRSVIDSLHEQASSLPREEDQDVHARLVGIEERYKEVSELTKL
RKQALQDALALYKMFSEANACEVWIDEKEQWLNSMEIPEKLEDLEVVQHRFESLEPEMNN
QASRVAVVNQIARQLMHNGHPSEKDIRTQQDKLNNRWSQFRDLMDQKKDSLNSALGVQNY
HLECNETKSWIIEKTKVIESTQELGNDLTGVMALQRKLTGMERDLAAIEDKLRDLRGEAQ
QLGEQHPDQAKAITGQLVEISTVWDEMKNTLKNREESLGEARKLQQFLRELDDFQSWLSR
TQTAIASEDMPNTLAEAEKLMAQHEGIKNEIHNYEEDYQKMRDMGEMVTQGQTDAQYMFL
RQRLQALDTGWNELHKMWENRQNLLSQSHAYQLFLRDTKQAEAFLNNQEYVLAHTEMPTT
LEGAEAAIKIHEDFMTTMDANEDKINFVVEAGRRLTSDGNINADRIQERVASIDGRQRRN
REAAVELLMRLKDNRDLQKFLQDCQELSLWINEKMLSAQDMSYDEARNLHSKWLKHQAFM
AELQSNKEWLQKIQKNGMLLVSEKPETEKVVKQKMMVLQTMWEELESTTQTKAQCLFDAN
KAELFTQSCADLDKWMGGLEGQIQSDDYGKDLTSVSILLKKQQMLENQVEVRQREVVELQ
SQVKALSQEVKDTDEVDGRRQLLEKKFQELLEPLQRRRNLLLASREVHQFNRDVEDEILW
VQERMAIATSTEHGYNLQTVQLLIKKNQTLQKEIQGHQPRTDDIMERSHSLLQDEASGTS
GIQQRLMELQELWSQLRKEVELRHSRLQEAHNAQQYYFDAAEAEAWMSEQELYMMSEEKA
KDEQSAVTMQKKHQVVEQAVEDYAETVHQLSKTSRGLVAEGHPESERISMRQSQVDKLYA
GLKDLSEERRGKLDERLRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFR
EFARDTGNIGQERVDTVNRLADELINSGHGDAATVAEWKDGLNEAWADLLELIDTRTQIL
AASFELHKFYHDAKEILGRIVDKQKKLPEEDGRDQNTVETLQRMHTTFEHDIQALGTQVR
QLQEDAVRLQSAYAGDKADDIQRRESEVLEAWRSLLEACDERRLRLLDTGDKFRFFSMVR
DLMLWMEDVIRLIEAQEVPRDVSSVELLMNNHQGIKAEIDARNDIFTSCIELGKTLLARK
HYAAEEIKEKLLQLTDKRKEMIDKWEDRWEWLRLILEVHQFSRDAGVAEAWLLGQEPYLA
SREMGQSVDEVEKLIKRHEAFEKSAATWEERFSALERLTTMELLEVRRQQEEEERKRKPP
PPELSVTPQEAEFQKQRCVCVCACVSVSVSECFCPHSVPASLNGLPSDQDFPLDELNKQI
SRSLKWFRLPVQTQDGVDSVDVINGVAERSSKEPSPGASPTTGRKKKTSQSSTLPSKNQD
LIGPSQLEGLLHRKHEWEGHNKKASNRSWHNVYCVITNGEMGFYKDSKAAAQGVSYHNEV
PVSLKEATCDIASDYKKKKHVFKLRLTDGNEYLFQAKDEEEMSSWIQAILNTASGDHGSS
PNTPPLGRAQTMPPAVTLASESSPGKREKEKEKEKEKRFSLFSKKK
Download sequence
Identical sequences H2U145
ENSTRUP00000030656 31033.ENSTRUP00000030656 ENSTRUP00000030656

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]