SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000031038 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000031038
Domain Number 1 Region: 3-238
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.31e-70
Family Calponin-homology domain, CH-domain 0.000022
Further Details:      
 
Domain Number 2 Region: 258-376
Classification Level Classification E-value
Superfamily Spectrin repeat 2.22e-31
Family Spectrin repeat 0.0002
Further Details:      
 
Domain Number 3 Region: 2496-2650
Classification Level Classification E-value
Superfamily Spectrin repeat 9.4e-29
Family Spectrin repeat 0.00056
Further Details:      
 
Domain Number 4 Region: 2813-2969
Classification Level Classification E-value
Superfamily Spectrin repeat 2.22e-28
Family Spectrin repeat 0.00067
Further Details:      
 
Domain Number 5 Region: 2708-2862
Classification Level Classification E-value
Superfamily Spectrin repeat 1.03e-27
Family Spectrin repeat 0.0011
Further Details:      
 
Domain Number 6 Region: 1236-1378
Classification Level Classification E-value
Superfamily Spectrin repeat 8.64e-26
Family Spectrin repeat 0.00029
Further Details:      
 
Domain Number 7 Region: 1650-1800
Classification Level Classification E-value
Superfamily Spectrin repeat 4.68e-22
Family Spectrin repeat 0.0017
Further Details:      
 
Domain Number 8 Region: 1752-1905
Classification Level Classification E-value
Superfamily Spectrin repeat 8.11e-22
Family Spectrin repeat 0.0011
Further Details:      
 
Domain Number 9 Region: 1448-1589
Classification Level Classification E-value
Superfamily Spectrin repeat 9.6e-22
Family Spectrin repeat 0.00086
Further Details:      
 
Domain Number 10 Region: 561-699
Classification Level Classification E-value
Superfamily Spectrin repeat 1.8e-21
Family Spectrin repeat 0.0015
Further Details:      
 
Domain Number 11 Region: 2071-2223
Classification Level Classification E-value
Superfamily Spectrin repeat 7.2e-21
Family Spectrin repeat 0.00038
Further Details:      
 
Domain Number 12 Region: 822-956
Classification Level Classification E-value
Superfamily Spectrin repeat 6.17e-20
Family Spectrin repeat 0.0019
Further Details:      
 
Domain Number 13 Region: 2924-3070
Classification Level Classification E-value
Superfamily Spectrin repeat 1.31e-19
Family Spectrin repeat 0.0031
Further Details:      
 
Domain Number 14 Region: 3180-3283
Classification Level Classification E-value
Superfamily Spectrin repeat 2.09e-19
Family Spectrin repeat 0.00088
Further Details:      
 
Domain Number 15 Region: 3238-3383
Classification Level Classification E-value
Superfamily Spectrin repeat 2.4e-19
Family Spectrin repeat 0.003
Further Details:      
 
Domain Number 16 Region: 2285-2427
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000122
Family Spectrin repeat 0.0026
Further Details:      
 
Domain Number 17 Region: 1141-1270
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000733
Family Spectrin repeat 0.0028
Further Details:      
 
Domain Number 18 Region: 3079-3178
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000746
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 19 Region: 1023-1134
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000238
Family Spectrin repeat 0.0027
Further Details:      
 
Domain Number 20 Region: 1911-2021
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000744
Family Spectrin repeat 0.0025
Further Details:      
 
Domain Number 21 Region: 697-774,816-860
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000135
Family Spectrin repeat 0.002
Further Details:      
 
Domain Number 22 Region: 381-494
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000288
Family Spectrin repeat 0.0013
Further Details:      
 
Domain Number 23 Region: 498-592
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000327
Family Spectrin repeat 0.001
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000031038
Domain Number - Region: 3393-3449
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00032
Family Spectrin repeat 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000031038   Gene: ENSTRUG00000012260   Transcript: ENSTRUT00000031156
Sequence length 3450
Comment pep:novel scaffold:FUGU4:scaffold_136:699457:719026:1 gene:ENSTRUG00000012260 transcript:ENSTRUT00000031156 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GRVRELQEQRMLVQKKTFTKWMNSIFFNSGEKMELTDVYTELKTGVALIRLLELISRETL
PSPSRRKLRVHCLENNSIAINFLKTKIRVDLIGPENVVDGDRTLILGLLWIIILRFQIGP
INLDEAGGGASVAHRSAMEALLIWCQRKTAGYSGVDVKDFSSSWKDGRAFNALIHAHRPD
LFDYHRTCRDDSRANLEHAFSLAEREFGIMQLLEVDDMAVPRPDEKSIMTYVSLYYHYFS
RMKQGQTIQKRLAKIFGTLMQMDQLKVQYEKMVSDLLAWIKTKVLQLNSRNFPNSVGEMQ
KLMSSFKTYRTVEKPPKYQERGAIEAHLFSLKTQLAANNQRAYSPPEGKSLSDIEKSWFL
LERAEHERERALQEALLLLENLEQLAQKFRRKAALRENYLEDTLRLIRRQDLRGLCTLEE
AQAARRRLEALAADALAHEPRFGALKDMARSIVRGNYHSKELIIRSEESISRRWEEMLQQ
LREQRGLLGNVVQHLHVLRDIELVCQELNNLQAQAGSTELGKELAEVESLLQKQDLLEAQ
ISAHGETIGSISSTALKVKARDSQQIQSRVRALEMQYRSLVSLSSTRRTQLEAQFRLLEF
FHDCEELEAWLYECWLRLLAVRLGRDLNHIRLSLHKHKVLEAELQAQESLYQTVLKRGQA
LLSKQSHFHQRVVQKWIRTLKKQRSQLTDGATAWRHRLQAALTIKQYFADAAEANSWLGD
RKPLLTSEDYGKDESHTAVLLQRHLWVEKEIVAYSSEIGRLSEQARSAAELAALTVSGSW
KRRAFGKRRLTLRGSRFRILPLYRRSLSRWKCISTATPDPEYQRDTLESTQADLHQDYSF
LNHLVKSKIKTLEETLRLHRLDNSCQEFESWMDDKENVLNTFSSDTGDLDVVQAKYENFL
TELASGRGRLSDIIHMAEDLVRSRHSKEREIKARQRKISKRWDQIQHLKDEKGRELLSTA
DLQSFLQSCEETRTQLQAQLTGLDPVDPGQSHLSLPAQDEIQAQALRDIQVLEAKISYLR
SVANMKQDGSPAESAAILQEVEGLEVLLSQVNHQVAARQRLLQEARRLQSFQQQAKELRH
WMESIEERLLQEGKATDVASAISLFEQHLELQQEMEEQRSRLKEMENLSKSLQKGRTGGF
DIQQTLNGLSADCSKLDRLWLSRRQRLEQEVELQRLNQEADRIEATLSGHEARLKVTEVG
DSVDAVHSLLSRQDELEGLLRALDTRIDRFTGRSLELIDRRHHAAKQMKERSRSIQEAFR
KLSESSRERRSRLEASQKHQEFQRDSDELLLWMEEKFQVAEDESYRDPTNILRKLKRHEA
TEKEMKANEVRLDTLVQLGEEMIAGEHFGSRSIRIKTSELCSSWRRLENKMADRGDKLRQ
AGQQEQLMELLQDAELKIETIQWILNNAAKGHDLRSSRQLLKEHQQLEQEAKELAEKINS
IISRAKHLASNHFDSQRILRETENYLKLFKSLQKPLERRRAQLEVSVLLFVFYHDVDLEL
SWMAEHVPASGSTAHEKSLAGALSLMQKHKELQAEVTAHKTHLNLILEKGRSLAQTAKSQ
AEEVLRRCEHVRAAWAELEEACSGRAALLSKAVTREQLLLDCSELESRLTEMLGLVNTDD
CGRSQPATQSLITKHQVLEGKLEVLQMEVEELGAQVKEAALNWSLEELRRPFGHVSSLNQ
QLQHLAALRGQRLQEALQLHLFMRESSEMEDWMNQQRQTAESQDLGNDYQHVQVLRGKFE
SSLKQLEVGEGRLQICRDLCAQLIGSKHPQTSRIREKVQKLSACWEELKAAARRRQDHLQ
TAEECHRLYQDLSDALTLIQERQKSIPDDVAKDLRGVTSQMRKHEGLLHELAGTEQQLQE
QLDAVDSVLECCSPSLKLRLEEVQEEVVEQWEQLRGHAEQRGEELKVACQRFLFLNTVRD
YLLWCSQQVGSMSVEESISDVATANLQLAQHQQLWAEIEAREETYQQAVDMGEELQSQDR
RNRKEVLKRLDHLQAERDRLEKQWSQKQSWLEGVLLEQVFYRDVNNMDRISSSQEILLQK
SALGDRADEMEALLKRHDAFEKLLNSQDDKELAERLRKQLSREKSKRVQTRLKTLSRRRD
RIKELSVKHREELELSRALCIFKRDASEAEEWVSDWMMKMAEDNRADLSNMQAKMKLLQK
HQVFEAEILAHENIIASVLQSGETLASTHRLVSKEVRQMAADLAGHWEELKNAVVARGKA
LEDKRDFLEFLQKVEEVEVWIRQKEVMVNVGDVGEDYEHGVQLLKKLSSFRSSGDREVTM
DDAHVKAINRLAAKLETRQNDEDLVTVRRRRQQLNDRWSKFHGNLSNYKKKLERALVVHA
LIRELEEVRERANEKMLLIQGQDCGLDLDSVESLIRRHEETEREVIVIQERSKALESEVS
DQLRDGSVLTDKLKSKQKEVLKSLKTLDREGKVRKEKLQEAHQLQLFKANQRLLLEWSIK
QSSEMEERGLPKNRAEAEKLIVEHRDWKTELDARTERMGSIQEFGLGLIRSGHGSTSVIQ
RSLTQLEEAKSRLERAWQKRHTTLEQARTLQSFLVSVEQCESWISNKEAFLSNQNLGNSV
TEVEALQRKQAQFEEDLEAQLDRVHEVQKLAEELIQQKHYDSDNIRAKSRALTLRWGQLQ
QQSRARHEALVESLQLLQFLSSSYQVSVWLNERNVVALDENWREPTNLQAKLLKHQSFEA
EVLANRYRVDSLTKEAQELLSECPSAEAKVGPRLKELTDSWAALIHNCEEKKIRLHEAHQ
ALQLQRSLDDVEQSVVLVEKELANEDCGADLPSVNRLLKALQALEEELDGHRDRIQTLME
TAKNFHSQGNFLADEIQIRMGHLINRYNNLSEPLQGRRDILEAWQVLFQFHRDLEEELAW
LSSRLLSISTKDLGSSLSSTQQLLHRHQAVVQEIRSRRPLVQAVQEAGHSLVRGRHFASH
DIQERLQELKMLHEELTTEAAQKEKLLQEALSIYTFLTKVSELDLWMEEQKAGLESEDCG
RSEEAAEALLRKLDGVDVELENQRRIVAKLQEDGAPLQHLRHPISYLITEALPLVLQRFQ
GLVRLSLDRRVTLEDQLHLYVFEREAKELQTWLTSKKTAAESQDCGQDLEDVEVLQKKLE
VLVSEVSGLGQTRLTEIQQLGRGLKQHDQAQRRGEAVSQLWEDLKSSIKTRQESLQAAKE
IHQFQHDVDELKSWMAEKEAVLGSEEDQDLHSIQTLLRQHQELQRDLVLISEEVTRRREV
GVALKRRQPWARSSVTERLEELDSCWTSIQDQTHQRGVRLCEAEDVQKYLSHWTELMTWL
KEMMSLVRGEPLIMDGTDPEQLMKKHQEFRLQIDRQLGKSQLVKEEGRSLIRKGNFMSQQ
VQERICELEVLEESLQKVWEETRVLYEEELEILMLQRELEQAERWLSSYESSLMLEDGES
VSDVLELLKRQEDLEAMIQAQTDRFNTLQK
Download sequence
Identical sequences H2U277
ENSTRUP00000031038 ENSTRUP00000031038 31033.ENSTRUP00000031038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]