SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000031474 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000031474
Domain Number 1 Region: 31-197
Classification Level Classification E-value
Superfamily EF-hand 9.06e-23
Family Calmodulin-like 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000031474   Gene: ENSTRUG00000012428   Transcript: ENSTRUT00000031597
Sequence length 228
Comment pep:novel scaffold:FUGU4:scaffold_84:354530:356002:-1 gene:ENSTRUG00000012428 transcript:ENSTRUT00000031597 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YKGGLNNRSDCKRSKRRWWQQEMGLFYCSSVFSVSIEQIAVLHKRFRQLSHNDEKLRREH
FMAIPDLACNPIRSQIIQAFFDRRNFHQKDDGTVEEISFEQFLVVMSHFRPPSPHMTEEQ
RESVRRDKLRFLFNMHDTDNDGMITLEEYRHVVEELLSRSGALGKETAKSIADAAMLEVA
SISMGHMEPDEFYEGITFEHFLKLLGSFEIESKMSIRFLNMDTFTLCK
Download sequence
Identical sequences H2U3G3
ENSTRUP00000031474 31033.ENSTRUP00000031474 ENSTRUP00000031474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]